Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C4U0

Protein Details
Accession Q6C4U0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
162-190DAKLKKKFDDEEKKEKKDKKESKESKKTKBasic
NLS Segment(s)
PositionSequence
164-190KLKKKFDDEEKKEKKDKKESKESKKTK
Subcellular Location(s) plas 20, extr 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013248  Psh3/Shr3  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016020  C:membrane  
GO:0051082  F:unfolded protein binding  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
KEGG yli:YALI0E23716g  -  
Pfam View protein in Pfam  
PF08229  SHR3_chaperone  
Amino Acid Sequences MPTSASSISSALILCATSFSLGVLYSNWPYDFFTLWTAAPPESRYTASLDHYKAWYDCPMFVYHIHHTVIGLGLIGFFIKLYKPSESNKLFDGGSLFLYMVGVTIYLTNIRRGLASAVDGNWGDVDEHTGINVIAASQVMIVFVLLGVLGLQVGQWWAEREDAKLKKKFDDEEKKEKKDKKESKESKKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.07
10 0.07
11 0.1
12 0.11
13 0.13
14 0.13
15 0.13
16 0.15
17 0.16
18 0.16
19 0.14
20 0.15
21 0.15
22 0.14
23 0.15
24 0.16
25 0.15
26 0.15
27 0.15
28 0.16
29 0.17
30 0.18
31 0.17
32 0.18
33 0.2
34 0.22
35 0.27
36 0.26
37 0.25
38 0.25
39 0.26
40 0.24
41 0.23
42 0.24
43 0.19
44 0.19
45 0.18
46 0.19
47 0.18
48 0.19
49 0.22
50 0.19
51 0.21
52 0.21
53 0.19
54 0.17
55 0.16
56 0.14
57 0.1
58 0.08
59 0.04
60 0.04
61 0.03
62 0.03
63 0.03
64 0.02
65 0.03
66 0.03
67 0.05
68 0.07
69 0.09
70 0.12
71 0.15
72 0.24
73 0.26
74 0.27
75 0.26
76 0.26
77 0.24
78 0.21
79 0.2
80 0.12
81 0.1
82 0.09
83 0.08
84 0.06
85 0.06
86 0.05
87 0.04
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.05
94 0.06
95 0.07
96 0.08
97 0.08
98 0.08
99 0.09
100 0.1
101 0.08
102 0.09
103 0.08
104 0.08
105 0.1
106 0.1
107 0.09
108 0.08
109 0.08
110 0.07
111 0.06
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.06
120 0.04
121 0.03
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.04
142 0.04
143 0.06
144 0.08
145 0.11
146 0.12
147 0.15
148 0.25
149 0.32
150 0.4
151 0.45
152 0.47
153 0.5
154 0.55
155 0.59
156 0.6
157 0.64
158 0.64
159 0.69
160 0.76
161 0.78
162 0.82
163 0.82
164 0.81
165 0.81
166 0.83
167 0.82
168 0.84
169 0.86
170 0.89