Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072PUJ7

Protein Details
Accession A0A072PUJ7   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-94LTGSKKGNIRARPRLQRAHSHydrophilic
NLS Segment(s)
PositionSequence
32-48RRPARAGLRRGQVLRVR
54-64GVRHVRGKLRR
79-86KKGNIRAR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MPSPQTLPKTVQHPDVRPGDRLATLRTEHHARRPARAGLRRGQVLRVRELGGQGVRHVRGKLRREQCRRQQAAALTGSKKGNIRARPRLQRAHSADHTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.54
4 0.49
5 0.48
6 0.41
7 0.37
8 0.35
9 0.3
10 0.25
11 0.24
12 0.24
13 0.26
14 0.3
15 0.29
16 0.35
17 0.41
18 0.38
19 0.43
20 0.46
21 0.48
22 0.5
23 0.55
24 0.52
25 0.5
26 0.54
27 0.52
28 0.47
29 0.46
30 0.42
31 0.37
32 0.35
33 0.3
34 0.26
35 0.23
36 0.22
37 0.19
38 0.16
39 0.13
40 0.12
41 0.13
42 0.13
43 0.15
44 0.15
45 0.19
46 0.25
47 0.3
48 0.38
49 0.45
50 0.54
51 0.61
52 0.71
53 0.76
54 0.79
55 0.79
56 0.72
57 0.67
58 0.6
59 0.57
60 0.51
61 0.45
62 0.36
63 0.36
64 0.34
65 0.31
66 0.3
67 0.32
68 0.35
69 0.39
70 0.48
71 0.54
72 0.64
73 0.71
74 0.78
75 0.8
76 0.78
77 0.79
78 0.76
79 0.75