Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072PUE0

Protein Details
Accession A0A072PUE0   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-39VNVPKTRRTYCKGKTCKKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 6.5, cyto_nucl 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MLMHSSFQVNVPKTRRTYCKGKTCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTQCKTKAQLSLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.54
4 0.61
5 0.63
6 0.69
7 0.73
8 0.79
9 0.82
10 0.84
11 0.88
12 0.87
13 0.89
14 0.88
15 0.89
16 0.87
17 0.88
18 0.88
19 0.81
20 0.8
21 0.74
22 0.69
23 0.61
24 0.54
25 0.43
26 0.35
27 0.33
28 0.32
29 0.31
30 0.28
31 0.33
32 0.36
33 0.41
34 0.45
35 0.5
36 0.46
37 0.53
38 0.6
39 0.57
40 0.59
41 0.57
42 0.56
43 0.55
44 0.57
45 0.48
46 0.43
47 0.4
48 0.33
49 0.35
50 0.37
51 0.36
52 0.31
53 0.38
54 0.42
55 0.51
56 0.59
57 0.62
58 0.62
59 0.65
60 0.72
61 0.73
62 0.71
63 0.68
64 0.64
65 0.64
66 0.66
67 0.63
68 0.58
69 0.55
70 0.5
71 0.46
72 0.44
73 0.41
74 0.42
75 0.46
76 0.51
77 0.54
78 0.63
79 0.68
80 0.72
81 0.69
82 0.64
83 0.59
84 0.54
85 0.53
86 0.53
87 0.53
88 0.54
89 0.58
90 0.54
91 0.5
92 0.49
93 0.42