Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072P3X0

Protein Details
Accession A0A072P3X0   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
218-241AEGAEKKIRKVKKKVVQRAIGRAIHydrophilic
NLS Segment(s)
PositionSequence
222-232EKKIRKVKKKV
Subcellular Location(s) mito 10.5, cyto_mito 8, nucl 7, cyto 4.5, extr 3
Family & Domain DBs
Amino Acid Sequences MAAAMKPTSVWIERGHDGRHFYVRKKSSQPSLRKLLTQALLPGGARSFFSRDSRQNNHVQCENPDIPLIMPRPSSTGPMPTQGPGQPSTNPSSTQSQQLPQPIAMYLVPPLQDAPRPAVIETPIPSHMKPQPQFLPYFHPTIFPMPACYPVPDQGLPFVTPQPFMGHHPPFAAAPPGPFPDTLQACDTNVRFAAGSDLPGIIENTPSLLDNCRERLSAEGAEKKIRKVKKKVVQRAIGRAIIGVGTRELRAGIHSLVDILETGAVHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.34
4 0.37
5 0.38
6 0.44
7 0.43
8 0.44
9 0.5
10 0.53
11 0.57
12 0.6
13 0.64
14 0.65
15 0.7
16 0.74
17 0.73
18 0.77
19 0.72
20 0.66
21 0.62
22 0.58
23 0.51
24 0.42
25 0.36
26 0.28
27 0.26
28 0.23
29 0.22
30 0.15
31 0.13
32 0.12
33 0.13
34 0.14
35 0.16
36 0.21
37 0.27
38 0.34
39 0.42
40 0.48
41 0.51
42 0.57
43 0.58
44 0.59
45 0.56
46 0.51
47 0.45
48 0.47
49 0.43
50 0.34
51 0.3
52 0.25
53 0.21
54 0.23
55 0.22
56 0.16
57 0.16
58 0.15
59 0.19
60 0.19
61 0.22
62 0.18
63 0.23
64 0.22
65 0.24
66 0.25
67 0.22
68 0.24
69 0.23
70 0.24
71 0.2
72 0.21
73 0.2
74 0.22
75 0.26
76 0.24
77 0.23
78 0.24
79 0.27
80 0.26
81 0.29
82 0.28
83 0.26
84 0.28
85 0.31
86 0.29
87 0.24
88 0.23
89 0.18
90 0.17
91 0.14
92 0.12
93 0.09
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.1
100 0.1
101 0.12
102 0.14
103 0.14
104 0.14
105 0.15
106 0.15
107 0.15
108 0.15
109 0.14
110 0.14
111 0.15
112 0.15
113 0.18
114 0.21
115 0.27
116 0.27
117 0.3
118 0.32
119 0.32
120 0.34
121 0.31
122 0.35
123 0.29
124 0.31
125 0.26
126 0.22
127 0.21
128 0.22
129 0.22
130 0.14
131 0.15
132 0.12
133 0.16
134 0.15
135 0.16
136 0.15
137 0.16
138 0.18
139 0.16
140 0.16
141 0.14
142 0.15
143 0.14
144 0.14
145 0.15
146 0.12
147 0.12
148 0.13
149 0.13
150 0.13
151 0.16
152 0.23
153 0.22
154 0.22
155 0.22
156 0.22
157 0.2
158 0.2
159 0.19
160 0.11
161 0.11
162 0.12
163 0.14
164 0.14
165 0.14
166 0.14
167 0.18
168 0.19
169 0.2
170 0.2
171 0.19
172 0.19
173 0.23
174 0.22
175 0.18
176 0.16
177 0.15
178 0.13
179 0.12
180 0.15
181 0.11
182 0.12
183 0.11
184 0.11
185 0.1
186 0.11
187 0.11
188 0.07
189 0.07
190 0.06
191 0.06
192 0.07
193 0.07
194 0.08
195 0.1
196 0.13
197 0.16
198 0.2
199 0.21
200 0.21
201 0.21
202 0.23
203 0.24
204 0.26
205 0.29
206 0.32
207 0.33
208 0.41
209 0.42
210 0.45
211 0.48
212 0.52
213 0.56
214 0.59
215 0.67
216 0.69
217 0.79
218 0.84
219 0.86
220 0.88
221 0.85
222 0.84
223 0.79
224 0.71
225 0.6
226 0.49
227 0.39
228 0.31
229 0.24
230 0.16
231 0.11
232 0.11
233 0.11
234 0.11
235 0.11
236 0.1
237 0.12
238 0.14
239 0.12
240 0.12
241 0.12
242 0.12
243 0.12
244 0.12
245 0.1
246 0.07
247 0.08