Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072P700

Protein Details
Accession A0A072P700   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-53DDNWTGLKDPKERRKRQVRLSLRAHRKRKAAQBasic
NLS Segment(s)
PositionSequence
31-51PKERRKRQVRLSLRAHRKRKA
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Pfam View protein in Pfam  
PF11905  DUF3425  
Amino Acid Sequences METPGRLRLGYMDQLAEAHCDDDNWTGLKDPKERRKRQVRLSLRAHRKRKAAQLAEREMPLHPNIEAESGTRHVIYPPSDNQAVRTTPNLFIPAALDQRGSFVPMRNLYPMSRDHLLPLVQYNAWRATLTNVLILGHLHLISQQTCRFGSCTTIFPNPYQRKSLPESLKPTELQRSTSYPDWIDIMPSPRMRDNATRTQRLISNAELCADLMGGISGKQHNIESAIIVWSDPWEPRGWELSQGFIRRWWFLVEGCNDLFEATNRWRDLRGDDPLVFERP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.16
5 0.12
6 0.1
7 0.1
8 0.11
9 0.13
10 0.14
11 0.13
12 0.13
13 0.16
14 0.21
15 0.27
16 0.34
17 0.42
18 0.51
19 0.6
20 0.69
21 0.76
22 0.82
23 0.86
24 0.88
25 0.89
26 0.88
27 0.87
28 0.89
29 0.89
30 0.89
31 0.89
32 0.87
33 0.83
34 0.81
35 0.78
36 0.78
37 0.78
38 0.76
39 0.75
40 0.76
41 0.76
42 0.7
43 0.64
44 0.55
45 0.45
46 0.38
47 0.3
48 0.22
49 0.15
50 0.13
51 0.13
52 0.13
53 0.12
54 0.1
55 0.12
56 0.12
57 0.13
58 0.12
59 0.12
60 0.12
61 0.15
62 0.16
63 0.18
64 0.19
65 0.24
66 0.26
67 0.26
68 0.27
69 0.28
70 0.28
71 0.24
72 0.25
73 0.22
74 0.21
75 0.22
76 0.22
77 0.17
78 0.16
79 0.16
80 0.16
81 0.15
82 0.14
83 0.13
84 0.11
85 0.13
86 0.13
87 0.13
88 0.12
89 0.12
90 0.16
91 0.18
92 0.19
93 0.19
94 0.2
95 0.18
96 0.2
97 0.2
98 0.19
99 0.19
100 0.18
101 0.17
102 0.18
103 0.18
104 0.16
105 0.15
106 0.12
107 0.11
108 0.12
109 0.12
110 0.11
111 0.11
112 0.11
113 0.1
114 0.1
115 0.12
116 0.12
117 0.1
118 0.09
119 0.09
120 0.09
121 0.09
122 0.07
123 0.05
124 0.05
125 0.04
126 0.05
127 0.06
128 0.06
129 0.09
130 0.09
131 0.11
132 0.11
133 0.12
134 0.12
135 0.11
136 0.15
137 0.14
138 0.16
139 0.17
140 0.21
141 0.21
142 0.22
143 0.32
144 0.33
145 0.34
146 0.36
147 0.34
148 0.35
149 0.39
150 0.47
151 0.42
152 0.43
153 0.48
154 0.46
155 0.48
156 0.44
157 0.41
158 0.4
159 0.35
160 0.32
161 0.28
162 0.28
163 0.29
164 0.3
165 0.3
166 0.23
167 0.22
168 0.21
169 0.18
170 0.17
171 0.15
172 0.16
173 0.18
174 0.19
175 0.2
176 0.21
177 0.23
178 0.24
179 0.29
180 0.33
181 0.39
182 0.45
183 0.48
184 0.47
185 0.48
186 0.48
187 0.45
188 0.41
189 0.34
190 0.3
191 0.26
192 0.25
193 0.22
194 0.19
195 0.15
196 0.12
197 0.09
198 0.05
199 0.05
200 0.04
201 0.04
202 0.06
203 0.07
204 0.08
205 0.09
206 0.09
207 0.1
208 0.12
209 0.12
210 0.11
211 0.11
212 0.11
213 0.1
214 0.1
215 0.09
216 0.09
217 0.1
218 0.1
219 0.1
220 0.11
221 0.12
222 0.15
223 0.19
224 0.18
225 0.24
226 0.24
227 0.28
228 0.32
229 0.34
230 0.32
231 0.32
232 0.34
233 0.28
234 0.29
235 0.26
236 0.22
237 0.21
238 0.28
239 0.27
240 0.28
241 0.27
242 0.26
243 0.24
244 0.22
245 0.21
246 0.15
247 0.18
248 0.18
249 0.25
250 0.26
251 0.28
252 0.3
253 0.31
254 0.36
255 0.37
256 0.4
257 0.39
258 0.38
259 0.42