Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072PKK3

Protein Details
Accession A0A072PKK3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-29LYVKGKHLSHQRGKRNTNPNTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR018266  Ribosomal_L35Ae_CS  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
PROSITE View protein in PROSITE  
PS01105  RIBOSOMAL_L35AE  
Amino Acid Sequences MVSGGGHRLYVKGKHLSHQRGKRNTNPNTSLLKIEGVEDTNAAKFYLGKRVAFVYRAQKERQGSKIRVIWGKVTRPHGNSGVVRARFVHNLPPKSFGASVRIFLYPSSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.49
3 0.57
4 0.63
5 0.68
6 0.72
7 0.74
8 0.79
9 0.81
10 0.81
11 0.79
12 0.78
13 0.73
14 0.68
15 0.63
16 0.58
17 0.5
18 0.4
19 0.34
20 0.24
21 0.21
22 0.17
23 0.13
24 0.11
25 0.1
26 0.1
27 0.09
28 0.09
29 0.08
30 0.07
31 0.07
32 0.08
33 0.16
34 0.18
35 0.17
36 0.18
37 0.2
38 0.21
39 0.21
40 0.23
41 0.23
42 0.27
43 0.3
44 0.3
45 0.32
46 0.35
47 0.38
48 0.43
49 0.42
50 0.39
51 0.41
52 0.44
53 0.44
54 0.44
55 0.41
56 0.4
57 0.37
58 0.41
59 0.4
60 0.43
61 0.44
62 0.43
63 0.46
64 0.42
65 0.42
66 0.37
67 0.38
68 0.39
69 0.35
70 0.33
71 0.31
72 0.31
73 0.29
74 0.29
75 0.33
76 0.33
77 0.39
78 0.4
79 0.43
80 0.41
81 0.42
82 0.43
83 0.35
84 0.33
85 0.29
86 0.29
87 0.27
88 0.27
89 0.24