Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C7G8

Protein Details
Accession Q6C7G8   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
123-147PSSAATNKVKKPKRPKKGSLLDAMNHydrophilic
NLS Segment(s)
PositionSequence
130-152KVKKPKRPKKGSLLDAMNKPKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, cyto 5, cyto_pero 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR011421  BCNT-C  
Gene Ontology GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
KEGG yli:YALI0E00946g  -  
Pfam View protein in Pfam  
PF07572  BCNT  
PROSITE View protein in PROSITE  
PS51279  BCNT_C  
Amino Acid Sequences MTNEDLLSDSENDEDFAYKSDKEEDFSDSDDESRKLQRRIDAENKQAMAKEEVKVDKDAMRKIYEEMKSGSGAANEIKPVTVKKPDVTTTQTTQQETASTTPTASTTSTTTSTTSAPAPASIPSSAATNKVKKPKRPKKGSLLDAMNKPKKKLNTLEQSKADWGAFVDKEGIGHDLSQHNKDGYLEKRDFLDTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.13
4 0.14
5 0.13
6 0.15
7 0.2
8 0.2
9 0.22
10 0.23
11 0.24
12 0.24
13 0.26
14 0.26
15 0.2
16 0.21
17 0.22
18 0.21
19 0.2
20 0.26
21 0.31
22 0.33
23 0.36
24 0.41
25 0.42
26 0.5
27 0.58
28 0.58
29 0.58
30 0.59
31 0.56
32 0.51
33 0.48
34 0.41
35 0.36
36 0.3
37 0.25
38 0.25
39 0.26
40 0.27
41 0.27
42 0.26
43 0.25
44 0.27
45 0.29
46 0.27
47 0.26
48 0.25
49 0.26
50 0.32
51 0.29
52 0.27
53 0.25
54 0.23
55 0.22
56 0.22
57 0.2
58 0.13
59 0.12
60 0.11
61 0.09
62 0.08
63 0.08
64 0.08
65 0.08
66 0.09
67 0.11
68 0.15
69 0.16
70 0.18
71 0.21
72 0.23
73 0.26
74 0.29
75 0.3
76 0.28
77 0.33
78 0.34
79 0.31
80 0.3
81 0.26
82 0.22
83 0.2
84 0.18
85 0.13
86 0.1
87 0.1
88 0.09
89 0.09
90 0.1
91 0.09
92 0.09
93 0.08
94 0.1
95 0.11
96 0.12
97 0.12
98 0.12
99 0.13
100 0.13
101 0.12
102 0.11
103 0.1
104 0.1
105 0.1
106 0.09
107 0.11
108 0.09
109 0.1
110 0.09
111 0.11
112 0.11
113 0.14
114 0.19
115 0.22
116 0.28
117 0.38
118 0.44
119 0.52
120 0.63
121 0.69
122 0.75
123 0.8
124 0.83
125 0.84
126 0.87
127 0.84
128 0.81
129 0.78
130 0.73
131 0.7
132 0.71
133 0.68
134 0.61
135 0.57
136 0.55
137 0.52
138 0.53
139 0.54
140 0.54
141 0.57
142 0.63
143 0.7
144 0.67
145 0.64
146 0.59
147 0.52
148 0.42
149 0.31
150 0.24
151 0.2
152 0.17
153 0.16
154 0.16
155 0.14
156 0.14
157 0.15
158 0.15
159 0.1
160 0.1
161 0.13
162 0.18
163 0.22
164 0.24
165 0.26
166 0.25
167 0.25
168 0.27
169 0.31
170 0.31
171 0.36
172 0.35
173 0.34
174 0.36