Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CE99

Protein Details
Accession Q6CE99    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-40EVIEKPKKSAKKRLEVKKWSAVAHydrophilic
NLS Segment(s)
PositionSequence
22-32KPKKSAKKRLE
Subcellular Location(s) cyto 12, cyto_nucl 11, nucl 8, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR024766  Znf_RING_H2  
Gene Ontology GO:0031463  C:Cul3-RING ubiquitin ligase complex  
GO:0035361  C:Cul8-RING ubiquitin ligase complex  
GO:0031461  C:cullin-RING ubiquitin ligase complex  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0019005  C:SCF ubiquitin ligase complex  
GO:0097602  F:cullin family protein binding  
GO:0030674  F:protein-macromolecule adaptor activity  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
GO:0000082  P:G1/S transition of mitotic cell cycle  
GO:0010828  P:positive regulation of glucose transmembrane transport  
GO:0016567  P:protein ubiquitination  
GO:0031146  P:SCF-dependent proteasomal ubiquitin-dependent protein catabolic process  
GO:0030466  P:silent mating-type cassette heterochromatin formation  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
KEGG yli:YALI0B17358g  -  
Pfam View protein in Pfam  
PF12678  zf-rbx1  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16485  mRING-H2-C3H2C2D_RBX1  
Amino Acid Sequences MADPSAMEVDTPVEQVEEVIEKPKKSAKKRLEVKKWSAVAFWSWDIQVETCAICKNHIMEPCIDCQANASGTQADCNVAWGKCNHAFHFHCINRWLKSRNTCPLDSKDWEFTRYGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.08
5 0.08
6 0.15
7 0.19
8 0.18
9 0.21
10 0.27
11 0.35
12 0.41
13 0.51
14 0.53
15 0.61
16 0.7
17 0.79
18 0.84
19 0.83
20 0.83
21 0.81
22 0.74
23 0.64
24 0.55
25 0.45
26 0.36
27 0.3
28 0.24
29 0.16
30 0.12
31 0.13
32 0.12
33 0.11
34 0.1
35 0.08
36 0.07
37 0.07
38 0.09
39 0.08
40 0.08
41 0.09
42 0.11
43 0.14
44 0.16
45 0.17
46 0.17
47 0.18
48 0.19
49 0.21
50 0.18
51 0.14
52 0.13
53 0.13
54 0.12
55 0.11
56 0.1
57 0.09
58 0.09
59 0.1
60 0.09
61 0.09
62 0.08
63 0.1
64 0.12
65 0.11
66 0.13
67 0.13
68 0.18
69 0.23
70 0.26
71 0.25
72 0.3
73 0.32
74 0.36
75 0.46
76 0.42
77 0.4
78 0.42
79 0.46
80 0.43
81 0.48
82 0.47
83 0.44
84 0.52
85 0.57
86 0.62
87 0.63
88 0.61
89 0.61
90 0.63
91 0.62
92 0.58
93 0.55
94 0.54
95 0.5
96 0.49