FuNGI

Q6C7Q8

Protein Details

Accession

Q6C7Q8

Localization Confidence

High

Confidence Score

19.4

NoLS Segment(s)

Position	Sequence	Protein Nature
55-74	ITKGNKGRLKKTQTNDRSAA	Hydrophilic
297-316	SSPKPPPKPAKRPPALKPKP	Basic
618-638	DDSRWKWRNAHDLPKPRRFEG	Basic

NLS Segment(s)

Position	Sequence
298-326	SPKPPPKPAKRPPALKPKPKIPTPGLKPA

Subcellular Location(s)

nucl 24, cyto_nucl 13.5

Family & Domain DBs

InterPro	View protein in InterPro IPR003124 WH2_dom
Gene Ontology	GO:0030479 C:actin cortical patch GO:0003779 F:actin binding
KEGG	yli:YALI0D26191g -
Pfam	View protein in Pfam PF02205 WH2
PROSITE	View protein in PROSITE PS51082 WH2

Amino Acid Sequences

MPAPPPPPPPPPPGFGGPPPPPPPGGGFGALSSGGAPKAGPPKGAPSRDALFSDITKGNKGRLKKTQTNDRSAAQTGGGGVLSGGAPKGPSSAPAVPGMGMGAPAVPGMGAPAVPGMGAPAVPGMGAPAAPSAPAAASAPSAPAMAQQDMSGLFAGGMPKLKKRGGNISLTDDHSSSGNSSPPQGGAPAIPSLRKTSGAPSAPGGFAPPPPPAPPGGAPAIPGAPSVASSYRSASASSGAPPPPPGGAPPIPGGAPPPLPGKVSTSGGAPTFGAPPPPPPGGAPAYGAPAPPTPGTSSPKPPPKPAKRPPALKPKPKIPTPGLKPAVPTPGQRRSVSPSPGAPPPPIPGSVAPSVRHAPSQSVSSIASSVSTPSTPPPAPPAPPPVPGGAAPPIPGSAAPPAPPPAPPAGFGAPAPPSFGAPTPPPAPPAPSAPPAPPAPPAPPSEPPSTPRGPAMFGAPMPKSPAAASPGAPPPPPPGAAAPGLAPPAPPAQPPSPGRPSGAPPPPPGPPAPPTDQFHSMILDDGSSSGSHGAPPPPPPSAPPSNGGHSHGAPPPPPPNGGVNRRRDVVQRTSTLGSNNIRTLDTSAYTIAPRAVSTPVGSSSGGGGGSKPPQIKIDDSRWKWRNAHDLPKPRRFEGKTKLYASGRGSSVPLNLAAYE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.52
2	0.49
3	0.52
4	0.49
5	0.53
6	0.54
7	0.51
8	0.47
9	0.43
10	0.41
11	0.37
12	0.35
13	0.29
14	0.25
15	0.22
16	0.23
17	0.21
18	0.17
19	0.13
20	0.11
21	0.09
22	0.08
23	0.08
24	0.12
25	0.2
26	0.22
27	0.23
28	0.24
29	0.34
30	0.43
31	0.47
32	0.43
33	0.41
34	0.43
35	0.44
36	0.44
37	0.36
38	0.3
39	0.27
40	0.31
41	0.29
42	0.27
43	0.29
44	0.29
45	0.34
46	0.36
47	0.42
48	0.45
49	0.51
50	0.59
51	0.63
52	0.71
53	0.75
54	0.79
55	0.81
56	0.76
57	0.69
58	0.64
59	0.57
60	0.49
61	0.38
62	0.3
63	0.21
64	0.18
65	0.14
66	0.09
67	0.07
68	0.06
69	0.06
70	0.06
71	0.05
72	0.05
73	0.05
74	0.05
75	0.08
76	0.08
77	0.09
78	0.15
79	0.18
80	0.2
81	0.22
82	0.22
83	0.2
84	0.2
85	0.18
86	0.12
87	0.09
88	0.07
89	0.05
90	0.05
91	0.04
92	0.04
93	0.03
94	0.03
95	0.04
96	0.04
97	0.04
98	0.04
99	0.04
100	0.04
101	0.04
102	0.04
103	0.04
104	0.04
105	0.04
106	0.04
107	0.04
108	0.04
109	0.04
110	0.04
111	0.04
112	0.04
113	0.04
114	0.04
115	0.05
116	0.05
117	0.05
118	0.05
119	0.05
120	0.05
121	0.06
122	0.06
123	0.06
124	0.07
125	0.07
126	0.08
127	0.08
128	0.08
129	0.07
130	0.09
131	0.12
132	0.12
133	0.12
134	0.11
135	0.12
136	0.12
137	0.13
138	0.1
139	0.07
140	0.06
141	0.07
142	0.08
143	0.07
144	0.12
145	0.13
146	0.16
147	0.21
148	0.25
149	0.27
150	0.31
151	0.4
152	0.41
153	0.47
154	0.46
155	0.48
156	0.48
157	0.48
158	0.45
159	0.35
160	0.3
161	0.23
162	0.2
163	0.15
164	0.13
165	0.13
166	0.12
167	0.14
168	0.14
169	0.14
170	0.14
171	0.13
172	0.12
173	0.1
174	0.11
175	0.12
176	0.12
177	0.13
178	0.14
179	0.17
180	0.17
181	0.19
182	0.18
183	0.19
184	0.26
185	0.27
186	0.27
187	0.25
188	0.26
189	0.24
190	0.23
191	0.21
192	0.14
193	0.13
194	0.14
195	0.14
196	0.14
197	0.15
198	0.16
199	0.16
200	0.17
201	0.17
202	0.18
203	0.19
204	0.17
205	0.17
206	0.16
207	0.16
208	0.13
209	0.12
210	0.09
211	0.06
212	0.07
213	0.07
214	0.08
215	0.09
216	0.1
217	0.12
218	0.13
219	0.14
220	0.14
221	0.13
222	0.13
223	0.12
224	0.14
225	0.16
226	0.15
227	0.15
228	0.16
229	0.16
230	0.15
231	0.14
232	0.13
233	0.14
234	0.14
235	0.16
236	0.16
237	0.16
238	0.15
239	0.15
240	0.16
241	0.12
242	0.11
243	0.11
244	0.12
245	0.12
246	0.13
247	0.14
248	0.16
249	0.17
250	0.18
251	0.17
252	0.15
253	0.16
254	0.15
255	0.15
256	0.12
257	0.1
258	0.1
259	0.1
260	0.11
261	0.09
262	0.11
263	0.15
264	0.15
265	0.14
266	0.13
267	0.17
268	0.17
269	0.17
270	0.16
271	0.13
272	0.15
273	0.14
274	0.14
275	0.11
276	0.1
277	0.11
278	0.09
279	0.1
280	0.1
281	0.13
282	0.18
283	0.2
284	0.26
285	0.32
286	0.41
287	0.42
288	0.49
289	0.56
290	0.61
291	0.69
292	0.72
293	0.76
294	0.74
295	0.79
296	0.8
297	0.8
298	0.79
299	0.77
300	0.73
301	0.71
302	0.7
303	0.66
304	0.64
305	0.57
306	0.57
307	0.53
308	0.59
309	0.52
310	0.46
311	0.44
312	0.4
313	0.4
314	0.32
315	0.3
316	0.27
317	0.33
318	0.36
319	0.35
320	0.35
321	0.37
322	0.41
323	0.41
324	0.36
325	0.3
326	0.29
327	0.31
328	0.31
329	0.25
330	0.2
331	0.19
332	0.19
333	0.17
334	0.16
335	0.13
336	0.15
337	0.18
338	0.19
339	0.18
340	0.19
341	0.2
342	0.2
343	0.2
344	0.16
345	0.15
346	0.14
347	0.15
348	0.13
349	0.12
350	0.12
351	0.11
352	0.11
353	0.09
354	0.08
355	0.06
356	0.07
357	0.06
358	0.06
359	0.06
360	0.07
361	0.12
362	0.12
363	0.12
364	0.17
365	0.19
366	0.21
367	0.23
368	0.3
369	0.28
370	0.3
371	0.31
372	0.26
373	0.24
374	0.23
375	0.22
376	0.16
377	0.14
378	0.12
379	0.11
380	0.1
381	0.09
382	0.09
383	0.08
384	0.08
385	0.09
386	0.09
387	0.1
388	0.12
389	0.12
390	0.13
391	0.14
392	0.15
393	0.15
394	0.16
395	0.18
396	0.17
397	0.17
398	0.16
399	0.16
400	0.15
401	0.14
402	0.14
403	0.11
404	0.1
405	0.11
406	0.11
407	0.12
408	0.11
409	0.15
410	0.16
411	0.17
412	0.19
413	0.18
414	0.21
415	0.2
416	0.24
417	0.23
418	0.24
419	0.26
420	0.24
421	0.27
422	0.25
423	0.25
424	0.22
425	0.21
426	0.2
427	0.22
428	0.24
429	0.25
430	0.29
431	0.32
432	0.35
433	0.35
434	0.35
435	0.38
436	0.37
437	0.33
438	0.31
439	0.28
440	0.25
441	0.23
442	0.23
443	0.18
444	0.17
445	0.2
446	0.17
447	0.17
448	0.19
449	0.18
450	0.16
451	0.15
452	0.17
453	0.17
454	0.17
455	0.18
456	0.19
457	0.23
458	0.24
459	0.24
460	0.22
461	0.23
462	0.24
463	0.24
464	0.2
465	0.18
466	0.19
467	0.2
468	0.19
469	0.16
470	0.15
471	0.15
472	0.13
473	0.11
474	0.1
475	0.12
476	0.12
477	0.12
478	0.16
479	0.17
480	0.25
481	0.28
482	0.34
483	0.38
484	0.38
485	0.4
486	0.38
487	0.4
488	0.41
489	0.46
490	0.43
491	0.4
492	0.42
493	0.43
494	0.43
495	0.4
496	0.35
497	0.31
498	0.32
499	0.34
500	0.37
501	0.38
502	0.41
503	0.44
504	0.41
505	0.38
506	0.34
507	0.28
508	0.23
509	0.2
510	0.14
511	0.1
512	0.09
513	0.09
514	0.07
515	0.07
516	0.07
517	0.07
518	0.08
519	0.11
520	0.14
521	0.16
522	0.2
523	0.23
524	0.24
525	0.25
526	0.26
527	0.31
528	0.35
529	0.35
530	0.36
531	0.37
532	0.39
533	0.41
534	0.42
535	0.39
536	0.33
537	0.35
538	0.34
539	0.33
540	0.29
541	0.31
542	0.33
543	0.32
544	0.31
545	0.29
546	0.33
547	0.39
548	0.48
549	0.52
550	0.55
551	0.57
552	0.58
553	0.58
554	0.56
555	0.54
556	0.54
557	0.52
558	0.46
559	0.47
560	0.47
561	0.47
562	0.42
563	0.42
564	0.37
565	0.33
566	0.33
567	0.3
568	0.28
569	0.27
570	0.28
571	0.24
572	0.21
573	0.18
574	0.17
575	0.17
576	0.17
577	0.17
578	0.16
579	0.14
580	0.13
581	0.13
582	0.14
583	0.14
584	0.14
585	0.16
586	0.16
587	0.17
588	0.17
589	0.16
590	0.15
591	0.15
592	0.14
593	0.11
594	0.11
595	0.12
596	0.16
597	0.2
598	0.21
599	0.22
600	0.25
601	0.29
602	0.34
603	0.38
604	0.45
605	0.51
606	0.55
607	0.64
608	0.65
609	0.69
610	0.68
611	0.68
612	0.68
613	0.66
614	0.71
615	0.71
616	0.76
617	0.79
618	0.84
619	0.82
620	0.75
621	0.77
622	0.72
623	0.72
624	0.71
625	0.72
626	0.71
627	0.69
628	0.74
629	0.66
630	0.66
631	0.61
632	0.57
633	0.48
634	0.4
635	0.38
636	0.32
637	0.32
638	0.27
639	0.23

Q6C7Q8

3D AlphaFold-predicted Structure Viewer