Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072P702

Protein Details
Accession A0A072P702   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-92GKPGAKPAKRGRPNRPKPKTAEBasic
NLS Segment(s)
PositionSequence
47-89KAQPKSAANVKKTTAKDGTKGRSAGKPGAKPAKRGRPNRPKPK
Subcellular Location(s) cyto 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MLIEVVVDASHVPEPTKAKSLADRVAYADPKRSAKSDPLTKTSANPKAQPKSAANVKKTTAKDGTKGRSAGKPGAKPAKRGRPNRPKPKTAEELDAEMTDYWGGNNPSAGGATTQTATNGAASAAAAGDDAMDEISVSEVEFIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.26
4 0.25
5 0.26
6 0.32
7 0.37
8 0.39
9 0.38
10 0.35
11 0.33
12 0.38
13 0.41
14 0.36
15 0.36
16 0.35
17 0.36
18 0.37
19 0.36
20 0.33
21 0.35
22 0.43
23 0.45
24 0.46
25 0.47
26 0.48
27 0.47
28 0.48
29 0.5
30 0.5
31 0.44
32 0.45
33 0.49
34 0.51
35 0.53
36 0.53
37 0.46
38 0.44
39 0.49
40 0.5
41 0.45
42 0.43
43 0.42
44 0.45
45 0.44
46 0.42
47 0.4
48 0.34
49 0.37
50 0.41
51 0.43
52 0.39
53 0.4
54 0.37
55 0.34
56 0.35
57 0.35
58 0.33
59 0.31
60 0.32
61 0.4
62 0.39
63 0.43
64 0.48
65 0.53
66 0.57
67 0.63
68 0.69
69 0.7
70 0.8
71 0.85
72 0.84
73 0.8
74 0.78
75 0.77
76 0.73
77 0.65
78 0.6
79 0.5
80 0.45
81 0.4
82 0.33
83 0.26
84 0.19
85 0.16
86 0.1
87 0.09
88 0.06
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.08
103 0.09
104 0.09
105 0.08
106 0.08
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.04
113 0.04
114 0.03
115 0.03
116 0.03
117 0.04
118 0.03
119 0.03
120 0.03
121 0.04
122 0.05
123 0.05
124 0.05