Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072P1F1

Protein Details
Accession A0A072P1F1   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
177-196ESDLKKRPIIGRRQSRWENSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, nucl 9, cysk 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029068  Glyas_Bleomycin-R_OHBP_Dase  
IPR004360  Glyas_Fos-R_dOase_dom  
IPR037523  VOC  
IPR000486  Xdiol_ring_cleave_dOase_1/2  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0008198  F:ferrous iron binding  
GO:0019439  P:aromatic compound catabolic process  
Pfam View protein in Pfam  
PF00903  Glyoxalase  
PROSITE View protein in PROSITE  
PS00082  EXTRADIOL_DIOXYGENAS  
PS51819  VOC  
CDD cd08348  BphC2-C3-RGP6_C_like  
Amino Acid Sequences MAADESTEKLISPTSMGHFGVRTPPEHYQAMVKWHLDFFGGKTVWQNDVATMITFDDEHHREVIVSDAAYKLIEDRRHAAGIYHIAFNLPTLADLATSYEQKKARGIVPHWPVNHGMTTSMYYFDPTGNEFELQVNNFDTTEEARQFMESAEFKENSIGVDLVVDDWIKKVRSCEDESDLKKRPIIGRRQSRWENSIYFKLEDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.18
3 0.19
4 0.19
5 0.19
6 0.19
7 0.26
8 0.25
9 0.24
10 0.25
11 0.28
12 0.32
13 0.32
14 0.32
15 0.3
16 0.3
17 0.35
18 0.34
19 0.31
20 0.27
21 0.27
22 0.26
23 0.22
24 0.2
25 0.15
26 0.19
27 0.18
28 0.17
29 0.21
30 0.22
31 0.23
32 0.24
33 0.22
34 0.14
35 0.16
36 0.16
37 0.12
38 0.11
39 0.09
40 0.08
41 0.08
42 0.08
43 0.13
44 0.14
45 0.15
46 0.15
47 0.15
48 0.14
49 0.14
50 0.16
51 0.11
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.12
60 0.14
61 0.15
62 0.18
63 0.2
64 0.21
65 0.21
66 0.19
67 0.16
68 0.19
69 0.19
70 0.16
71 0.13
72 0.13
73 0.12
74 0.12
75 0.1
76 0.06
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.06
83 0.07
84 0.08
85 0.09
86 0.13
87 0.15
88 0.15
89 0.17
90 0.17
91 0.19
92 0.23
93 0.24
94 0.28
95 0.33
96 0.37
97 0.36
98 0.35
99 0.33
100 0.29
101 0.28
102 0.19
103 0.14
104 0.1
105 0.11
106 0.1
107 0.1
108 0.09
109 0.09
110 0.09
111 0.09
112 0.09
113 0.09
114 0.1
115 0.1
116 0.1
117 0.1
118 0.11
119 0.12
120 0.12
121 0.12
122 0.11
123 0.11
124 0.1
125 0.1
126 0.1
127 0.1
128 0.13
129 0.13
130 0.13
131 0.13
132 0.13
133 0.13
134 0.13
135 0.15
136 0.12
137 0.15
138 0.19
139 0.19
140 0.19
141 0.2
142 0.2
143 0.15
144 0.16
145 0.12
146 0.08
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.05
153 0.07
154 0.1
155 0.12
156 0.13
157 0.15
158 0.21
159 0.28
160 0.32
161 0.37
162 0.39
163 0.47
164 0.51
165 0.56
166 0.56
167 0.52
168 0.49
169 0.49
170 0.51
171 0.51
172 0.57
173 0.59
174 0.64
175 0.69
176 0.77
177 0.8
178 0.79
179 0.74
180 0.69
181 0.64
182 0.6
183 0.6
184 0.54