Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A072PSH3

Protein Details
Accession A0A072PSH3    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-51SSSPGIWRCFRRRRRQDLRRLPPSTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 10.166, cyto_nucl 9.333, mito 7.5, cyto 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGRRKASLNFWLSWHWWWLSTLCFSSSSPGIWRCFRRRRRQDLRRLPPSTSPSSNSNSNSNHHLAMQKSYTRCSPRNRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.25
3 0.21
4 0.21
5 0.19
6 0.18
7 0.18
8 0.18
9 0.16
10 0.17
11 0.16
12 0.17
13 0.16
14 0.15
15 0.16
16 0.19
17 0.21
18 0.24
19 0.31
20 0.37
21 0.47
22 0.55
23 0.63
24 0.69
25 0.77
26 0.83
27 0.86
28 0.88
29 0.9
30 0.9
31 0.89
32 0.81
33 0.73
34 0.68
35 0.63
36 0.58
37 0.49
38 0.42
39 0.36
40 0.38
41 0.41
42 0.37
43 0.37
44 0.34
45 0.34
46 0.36
47 0.34
48 0.31
49 0.28
50 0.3
51 0.26
52 0.28
53 0.3
54 0.31
55 0.31
56 0.34
57 0.39
58 0.43
59 0.48
60 0.53