Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A072P218

Protein Details
Accession A0A072P218    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
41-64PYPSNTCRVFNRRKQCWRVFISRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences SPTSNLQAKAEKMEKLTPLISNVSIVEPWEHKPRKRTATTPYPSNTCRVFNRRKQCWRVFISRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.32
4 0.25
5 0.24
6 0.23
7 0.2
8 0.17
9 0.16
10 0.13
11 0.11
12 0.11
13 0.1
14 0.1
15 0.12
16 0.21
17 0.25
18 0.27
19 0.33
20 0.4
21 0.47
22 0.5
23 0.51
24 0.5
25 0.57
26 0.59
27 0.59
28 0.55
29 0.53
30 0.49
31 0.49
32 0.43
33 0.37
34 0.4
35 0.44
36 0.5
37 0.54
38 0.64
39 0.7
40 0.78
41 0.83
42 0.84
43 0.84
44 0.82