Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CHL2

Protein Details
Accession Q6CHL2    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-38LSLKRRDSCKTWRRSRCRGIMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 10.333, nucl 6.5, cyto_nucl 6.333, cyto 5
Family & Domain DBs
KEGG yli:YALI0A07711g  -  
Amino Acid Sequences MSSSETAFIAAKLQKSSLSLKRRDSCKTWRRSRCRGIMSNRDRTSNLTLGFSGGDCRSMIVSAGVVKAFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.27
4 0.31
5 0.37
6 0.4
7 0.48
8 0.55
9 0.59
10 0.61
11 0.6
12 0.62
13 0.63
14 0.67
15 0.69
16 0.72
17 0.76
18 0.8
19 0.82
20 0.8
21 0.78
22 0.75
23 0.72
24 0.73
25 0.71
26 0.72
27 0.65
28 0.59
29 0.52
30 0.48
31 0.45
32 0.38
33 0.32
34 0.23
35 0.22
36 0.2
37 0.2
38 0.16
39 0.14
40 0.1
41 0.1
42 0.09
43 0.1
44 0.1
45 0.1
46 0.1
47 0.08
48 0.09
49 0.09
50 0.11
51 0.1