Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072PRV7

Protein Details
Accession A0A072PRV7   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
227-253EKDTKQKDGTPVRRSQRKNKGVRNSSEHydrophilic
NLS Segment(s)
PositionSequence
148-150KRS
152-169TGLPTKAKARSKSRSITK
Subcellular Location(s) nucl 19.5, cyto_nucl 15.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences YIQTQMPPSRPDTPHLYPDTAPSTPYTSEIRPEYIERDTEFESIRQSVEPEMLLANWQRQSTPAHQDRSLTPSPISRRGDVDMLDSPLGRGEVPLMSPPITSVGTNTGRPISPTRPPIPPMPTGLSPFKVAKRDERHKSGVQGSKVDKRSVTGLPTKAKARSKSRSITKKLNSNRQPHPTVGELVGGEQSTMEISDNAAVTEPALFPLGRVGAEVANIEAQISQREEKDTKQKDGTPVRRSQRKNKGVRNSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.51
4 0.43
5 0.46
6 0.47
7 0.38
8 0.34
9 0.28
10 0.27
11 0.24
12 0.26
13 0.25
14 0.21
15 0.26
16 0.28
17 0.29
18 0.28
19 0.29
20 0.3
21 0.29
22 0.3
23 0.26
24 0.27
25 0.26
26 0.26
27 0.25
28 0.22
29 0.22
30 0.2
31 0.2
32 0.16
33 0.15
34 0.14
35 0.14
36 0.13
37 0.11
38 0.1
39 0.09
40 0.11
41 0.11
42 0.14
43 0.16
44 0.16
45 0.15
46 0.17
47 0.22
48 0.25
49 0.34
50 0.36
51 0.38
52 0.39
53 0.41
54 0.42
55 0.44
56 0.41
57 0.33
58 0.27
59 0.28
60 0.32
61 0.38
62 0.39
63 0.33
64 0.33
65 0.34
66 0.35
67 0.29
68 0.28
69 0.21
70 0.2
71 0.19
72 0.16
73 0.14
74 0.12
75 0.12
76 0.08
77 0.06
78 0.05
79 0.06
80 0.06
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.09
87 0.1
88 0.09
89 0.08
90 0.13
91 0.15
92 0.16
93 0.16
94 0.15
95 0.15
96 0.17
97 0.2
98 0.18
99 0.21
100 0.26
101 0.29
102 0.3
103 0.32
104 0.35
105 0.35
106 0.33
107 0.31
108 0.28
109 0.26
110 0.27
111 0.26
112 0.23
113 0.21
114 0.21
115 0.21
116 0.22
117 0.22
118 0.28
119 0.35
120 0.43
121 0.48
122 0.52
123 0.55
124 0.52
125 0.55
126 0.54
127 0.51
128 0.44
129 0.42
130 0.4
131 0.42
132 0.43
133 0.4
134 0.32
135 0.27
136 0.29
137 0.26
138 0.26
139 0.24
140 0.26
141 0.28
142 0.32
143 0.34
144 0.36
145 0.41
146 0.44
147 0.47
148 0.5
149 0.54
150 0.59
151 0.66
152 0.69
153 0.7
154 0.73
155 0.7
156 0.72
157 0.73
158 0.76
159 0.74
160 0.72
161 0.74
162 0.72
163 0.69
164 0.61
165 0.56
166 0.47
167 0.41
168 0.33
169 0.26
170 0.18
171 0.16
172 0.15
173 0.12
174 0.09
175 0.07
176 0.06
177 0.05
178 0.05
179 0.05
180 0.04
181 0.05
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.06
188 0.08
189 0.07
190 0.06
191 0.08
192 0.07
193 0.07
194 0.09
195 0.1
196 0.09
197 0.09
198 0.1
199 0.09
200 0.1
201 0.1
202 0.08
203 0.08
204 0.08
205 0.08
206 0.07
207 0.08
208 0.1
209 0.13
210 0.14
211 0.15
212 0.21
213 0.23
214 0.29
215 0.39
216 0.43
217 0.47
218 0.51
219 0.55
220 0.59
221 0.68
222 0.71
223 0.69
224 0.72
225 0.75
226 0.78
227 0.81
228 0.83
229 0.83
230 0.84
231 0.86
232 0.87
233 0.88