Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A072PD29

Protein Details
Accession A0A072PD29    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
92-115SQTSEQPRRKPPKLGPRKSAPSTTHydrophilic
NLS Segment(s)
PositionSequence
99-109RRKPPKLGPRK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MPNVSFDVFFDKDFINITATRGITAPKAKPDWKVRTAPKLPPKQTPVDNSTSGRTPRPPPREKLTSTRQSLNPKQQPHAAQGKVTELSDTASQTSEQPRRKPPKLGPRKSAPSTTPATTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.14
4 0.15
5 0.18
6 0.17
7 0.18
8 0.16
9 0.17
10 0.18
11 0.23
12 0.24
13 0.26
14 0.32
15 0.34
16 0.41
17 0.5
18 0.53
19 0.54
20 0.6
21 0.6
22 0.64
23 0.67
24 0.68
25 0.68
26 0.7
27 0.67
28 0.66
29 0.64
30 0.59
31 0.59
32 0.55
33 0.5
34 0.45
35 0.44
36 0.38
37 0.36
38 0.34
39 0.31
40 0.27
41 0.26
42 0.28
43 0.35
44 0.43
45 0.46
46 0.47
47 0.53
48 0.57
49 0.57
50 0.57
51 0.57
52 0.55
53 0.54
54 0.54
55 0.52
56 0.55
57 0.58
58 0.61
59 0.59
60 0.54
61 0.53
62 0.53
63 0.5
64 0.48
65 0.49
66 0.4
67 0.34
68 0.32
69 0.32
70 0.28
71 0.26
72 0.2
73 0.12
74 0.13
75 0.13
76 0.13
77 0.1
78 0.1
79 0.11
80 0.13
81 0.22
82 0.28
83 0.34
84 0.4
85 0.5
86 0.59
87 0.64
88 0.7
89 0.71
90 0.75
91 0.79
92 0.83
93 0.81
94 0.81
95 0.85
96 0.81
97 0.78
98 0.69
99 0.64
100 0.59