Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A072PRB9

Protein Details
Accession A0A072PRB9   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20TDSSKSDSRRHLRDARARPWHydrophilic
NLS Segment(s)
PositionSequence
77-86PGKGPKAVAK
Subcellular Location(s) mito 15, nucl 9, cyto 2
Family & Domain DBs
Amino Acid Sequences TDSSKSDSRRHLRDARARPWLINSVLRGRSTTELSSGLAESKDAPKLSVGIIVTAVPASLSSESVSGSSEKQSGQKPGKGPKAVAKVKALARSAGSKIPVWVGLSCAFSRCSLQASDSEERTTKDTTAAHPKVTKDTPASRLPVRVWRSIAARRPTTWQVRCSNTSGTHVAVSKDKGAGRTQQKLSSAAARNQGSIGKEPLRGSREGVKPRSILKHRAEDQGDAKPAPLTSLGQGVKSEPKKKVMWQEKLITAYLPSPGWPPRAFTCKRCRGIRYWDEGKKKYELHEGSPCWCPEAETEASALQRSLQDWLKDQLALGYDNVSNPVGYCTVAEGELHFEPLIPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.8
4 0.74
5 0.67
6 0.64
7 0.59
8 0.53
9 0.48
10 0.44
11 0.42
12 0.44
13 0.43
14 0.39
15 0.36
16 0.35
17 0.34
18 0.31
19 0.25
20 0.22
21 0.22
22 0.23
23 0.2
24 0.18
25 0.15
26 0.14
27 0.14
28 0.16
29 0.2
30 0.19
31 0.19
32 0.17
33 0.19
34 0.19
35 0.2
36 0.17
37 0.13
38 0.13
39 0.12
40 0.12
41 0.1
42 0.09
43 0.05
44 0.05
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.1
53 0.09
54 0.1
55 0.12
56 0.13
57 0.14
58 0.19
59 0.23
60 0.31
61 0.36
62 0.4
63 0.44
64 0.52
65 0.59
66 0.57
67 0.55
68 0.54
69 0.59
70 0.58
71 0.56
72 0.5
73 0.48
74 0.49
75 0.52
76 0.45
77 0.36
78 0.32
79 0.32
80 0.31
81 0.27
82 0.25
83 0.2
84 0.2
85 0.19
86 0.19
87 0.16
88 0.14
89 0.13
90 0.13
91 0.15
92 0.15
93 0.15
94 0.14
95 0.14
96 0.15
97 0.13
98 0.14
99 0.12
100 0.13
101 0.15
102 0.21
103 0.24
104 0.23
105 0.24
106 0.23
107 0.24
108 0.25
109 0.24
110 0.17
111 0.17
112 0.17
113 0.2
114 0.29
115 0.3
116 0.3
117 0.32
118 0.33
119 0.35
120 0.35
121 0.33
122 0.28
123 0.31
124 0.33
125 0.34
126 0.36
127 0.32
128 0.33
129 0.32
130 0.36
131 0.35
132 0.33
133 0.3
134 0.3
135 0.33
136 0.36
137 0.42
138 0.39
139 0.38
140 0.36
141 0.39
142 0.43
143 0.47
144 0.45
145 0.44
146 0.43
147 0.46
148 0.47
149 0.45
150 0.42
151 0.34
152 0.33
153 0.28
154 0.23
155 0.2
156 0.19
157 0.17
158 0.16
159 0.15
160 0.13
161 0.14
162 0.15
163 0.15
164 0.15
165 0.22
166 0.25
167 0.31
168 0.33
169 0.33
170 0.33
171 0.33
172 0.33
173 0.33
174 0.31
175 0.28
176 0.32
177 0.3
178 0.28
179 0.27
180 0.29
181 0.22
182 0.2
183 0.2
184 0.16
185 0.18
186 0.19
187 0.23
188 0.24
189 0.23
190 0.24
191 0.29
192 0.34
193 0.39
194 0.41
195 0.39
196 0.38
197 0.42
198 0.49
199 0.45
200 0.47
201 0.44
202 0.5
203 0.51
204 0.56
205 0.53
206 0.48
207 0.46
208 0.43
209 0.4
210 0.31
211 0.27
212 0.21
213 0.19
214 0.16
215 0.14
216 0.1
217 0.09
218 0.15
219 0.15
220 0.15
221 0.16
222 0.17
223 0.24
224 0.29
225 0.35
226 0.31
227 0.37
228 0.38
229 0.44
230 0.53
231 0.55
232 0.58
233 0.58
234 0.6
235 0.59
236 0.58
237 0.53
238 0.42
239 0.33
240 0.25
241 0.21
242 0.15
243 0.12
244 0.13
245 0.16
246 0.2
247 0.2
248 0.23
249 0.26
250 0.35
251 0.38
252 0.43
253 0.51
254 0.57
255 0.64
256 0.67
257 0.67
258 0.65
259 0.71
260 0.71
261 0.7
262 0.69
263 0.7
264 0.72
265 0.72
266 0.69
267 0.64
268 0.58
269 0.53
270 0.53
271 0.48
272 0.45
273 0.49
274 0.48
275 0.46
276 0.49
277 0.45
278 0.37
279 0.34
280 0.28
281 0.21
282 0.25
283 0.23
284 0.18
285 0.2
286 0.19
287 0.2
288 0.2
289 0.18
290 0.13
291 0.13
292 0.13
293 0.17
294 0.2
295 0.22
296 0.24
297 0.28
298 0.28
299 0.27
300 0.26
301 0.23
302 0.2
303 0.19
304 0.16
305 0.16
306 0.14
307 0.15
308 0.17
309 0.15
310 0.13
311 0.12
312 0.14
313 0.12
314 0.11
315 0.11
316 0.11
317 0.12
318 0.12
319 0.12
320 0.11
321 0.15
322 0.15
323 0.16
324 0.14