Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074X2Z8

Protein Details
Accession A0A074X2Z8    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-124QSPTMARRKAKRKVPKEQLALAHydrophilic
NLS Segment(s)
PositionSequence
108-118ARRKAKRKVPK
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
Amino Acid Sequences MPPKGSRVVHHDNDSRSDGSSSKTNHTAAKNKRPNGTSNLRDAKSVNDATGTQSASSSNGFTWAQEDLSLLQQYRAAHRMETPSAFNSIRNQFLLSNPGIGRQSPTMARRKAKRKVPKEQLALAVRKNFNDAAVNEIDVMVDLLYKVRNQDKAFRLRSAPNKSNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.47
3 0.4
4 0.35
5 0.28
6 0.25
7 0.29
8 0.27
9 0.28
10 0.31
11 0.32
12 0.36
13 0.42
14 0.48
15 0.51
16 0.59
17 0.64
18 0.65
19 0.7
20 0.66
21 0.64
22 0.63
23 0.63
24 0.55
25 0.56
26 0.59
27 0.52
28 0.51
29 0.46
30 0.41
31 0.38
32 0.34
33 0.25
34 0.18
35 0.18
36 0.2
37 0.22
38 0.19
39 0.13
40 0.12
41 0.12
42 0.12
43 0.12
44 0.1
45 0.07
46 0.1
47 0.1
48 0.09
49 0.1
50 0.1
51 0.09
52 0.08
53 0.09
54 0.07
55 0.09
56 0.1
57 0.09
58 0.08
59 0.11
60 0.11
61 0.13
62 0.15
63 0.13
64 0.13
65 0.15
66 0.17
67 0.17
68 0.17
69 0.16
70 0.14
71 0.17
72 0.17
73 0.16
74 0.18
75 0.19
76 0.19
77 0.18
78 0.18
79 0.16
80 0.16
81 0.19
82 0.14
83 0.15
84 0.14
85 0.15
86 0.15
87 0.14
88 0.16
89 0.12
90 0.15
91 0.16
92 0.21
93 0.27
94 0.33
95 0.4
96 0.47
97 0.56
98 0.62
99 0.68
100 0.74
101 0.75
102 0.8
103 0.84
104 0.84
105 0.8
106 0.76
107 0.74
108 0.69
109 0.64
110 0.56
111 0.53
112 0.45
113 0.4
114 0.39
115 0.31
116 0.26
117 0.27
118 0.24
119 0.21
120 0.2
121 0.2
122 0.17
123 0.17
124 0.15
125 0.1
126 0.1
127 0.05
128 0.04
129 0.04
130 0.05
131 0.06
132 0.08
133 0.12
134 0.17
135 0.25
136 0.27
137 0.37
138 0.44
139 0.53
140 0.57
141 0.57
142 0.57
143 0.59
144 0.66
145 0.67