Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074WQJ3

Protein Details
Accession A0A074WQJ3   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
105-137ADGGDAPKRKRNRNKNKKKKSKKPAASQNDSSRBasic
NLS Segment(s)
PositionSequence
111-129PKRKRNRNKNKKKKSKKPA
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039773  BAG_chaperone_regulator  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences SPGPPRDTDVLVLKSKRISYPVHFPAYTIEKGELRVKSVREQAAKKTGADARHIKLFFRGKNMKDDSNSCRAEGLRHNSEIMCVVGDAVPESMSSSDSEGEEASADGGDAPKRKRNRNKNKKKKSKKPAASQNDSSRTESPRPAPTPATPMDKLNAVNSTLQALLPQCVQFLANPPAEQAKKDFEHKRLSETVLAQVLLKLDAVDTEGDPDARARRKELVREAQNVLNSLDEKIKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.38
4 0.35
5 0.35
6 0.34
7 0.43
8 0.48
9 0.5
10 0.47
11 0.45
12 0.46
13 0.46
14 0.42
15 0.33
16 0.29
17 0.23
18 0.27
19 0.33
20 0.28
21 0.26
22 0.3
23 0.3
24 0.33
25 0.4
26 0.43
27 0.44
28 0.47
29 0.5
30 0.54
31 0.54
32 0.48
33 0.47
34 0.44
35 0.39
36 0.42
37 0.41
38 0.35
39 0.41
40 0.41
41 0.36
42 0.39
43 0.44
44 0.39
45 0.43
46 0.48
47 0.42
48 0.51
49 0.55
50 0.51
51 0.48
52 0.51
53 0.47
54 0.49
55 0.47
56 0.38
57 0.36
58 0.32
59 0.32
60 0.34
61 0.36
62 0.31
63 0.31
64 0.32
65 0.3
66 0.3
67 0.26
68 0.19
69 0.11
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.05
90 0.05
91 0.04
92 0.04
93 0.03
94 0.04
95 0.06
96 0.09
97 0.12
98 0.18
99 0.24
100 0.33
101 0.43
102 0.54
103 0.64
104 0.72
105 0.82
106 0.87
107 0.93
108 0.95
109 0.96
110 0.96
111 0.95
112 0.95
113 0.93
114 0.91
115 0.91
116 0.89
117 0.85
118 0.81
119 0.77
120 0.73
121 0.66
122 0.59
123 0.51
124 0.45
125 0.41
126 0.38
127 0.34
128 0.34
129 0.34
130 0.34
131 0.34
132 0.31
133 0.33
134 0.33
135 0.35
136 0.28
137 0.27
138 0.26
139 0.25
140 0.24
141 0.21
142 0.19
143 0.14
144 0.14
145 0.13
146 0.13
147 0.11
148 0.11
149 0.1
150 0.09
151 0.09
152 0.1
153 0.1
154 0.09
155 0.09
156 0.09
157 0.08
158 0.13
159 0.18
160 0.17
161 0.17
162 0.18
163 0.25
164 0.25
165 0.26
166 0.23
167 0.24
168 0.26
169 0.34
170 0.4
171 0.39
172 0.48
173 0.48
174 0.52
175 0.48
176 0.49
177 0.44
178 0.39
179 0.38
180 0.29
181 0.29
182 0.23
183 0.2
184 0.18
185 0.14
186 0.12
187 0.08
188 0.06
189 0.06
190 0.07
191 0.07
192 0.07
193 0.09
194 0.1
195 0.1
196 0.11
197 0.13
198 0.19
199 0.25
200 0.27
201 0.28
202 0.36
203 0.42
204 0.51
205 0.58
206 0.62
207 0.62
208 0.66
209 0.67
210 0.63
211 0.58
212 0.51
213 0.42
214 0.35
215 0.28
216 0.24