Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074WDW6

Protein Details
Accession A0A074WDW6    Localization Confidence High Confidence Score 22.9
NoLS Segment(s)
PositionSequenceProtein Nature
394-417MQASNKKKATPKKKGKQVKDEDEDHydrophilic
455-474EDYLRPKKREVKPKATPGSAHydrophilic
561-582AAKPAPKRKAPAPNVKKEKEEKBasic
NLS Segment(s)
PositionSequence
399-409KKKATPKKKGK
459-484RPKKREVKPKATPGSAKKATPAQKKK
561-579AAKPAPKRKAPAPNVKKEK
610-624KRPAPRAGARSSGRA
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004601  UvdE  
IPR036237  Xyl_isomerase-like_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0006289  P:nucleotide-excision repair  
GO:0009411  P:response to UV  
Pfam View protein in Pfam  
PF03851  UvdE  
Amino Acid Sequences MDDPEDEDFGEADEAEVNEASRRPPPVNSDYLPLPWKGRLGYACLNTYLRYSTPPVFASRTCRIASILEHRHPLRDPNEPEHPTKNRPDREQPASIERGQKYVEAIGLANARDLIKMLRWNDKYGIKFMRLSSEMFPFASHEEYGYKLTPFAAETLAEVGKVVAELGHRVTTHPGQFTQLGSPRKSVIDNALRDLEFHDEMLSLLKLPEQMNRDAVMILHLGGVFGDRAATLDRFRENYKTLPQGVKNRLVLENDDVSWSVHELLPICEELNIPMVLDYHHHNIIFDKEQIREGTKDICDLYPRIKATWDRKNIKQKMHYSEPTPAAITGTQRRKHNPRVATLPPCADDMDLMIEAKDKEQAVFELMRTFKLPGYDTFNEIIPHVREDDNKAAMQASNKKKATPKKKGKQVKDEDEDMEDDAGSVVDGETAALIPEEEVGMGGPEGRVYWPPGMEDYLRPKKREVKPKATPGSAKKATPAQKKKALADAIALEAAVKEQHESDEEAAEEATAATKKAKEALKARAAAARAKSDAMHSVTAPPTAAAAATAPTPAAAAAAAAAKPAPKRKAPAPNVKKEKEEKVEVTPPTSDDSELELNSSEDDAPINAPKRPAPRAGARSSGRASKAKVSYQEADVSMDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.09
5 0.11
6 0.13
7 0.15
8 0.17
9 0.21
10 0.23
11 0.27
12 0.34
13 0.38
14 0.45
15 0.45
16 0.45
17 0.43
18 0.46
19 0.44
20 0.39
21 0.35
22 0.3
23 0.31
24 0.27
25 0.3
26 0.27
27 0.31
28 0.36
29 0.38
30 0.38
31 0.38
32 0.39
33 0.34
34 0.34
35 0.3
36 0.23
37 0.22
38 0.25
39 0.25
40 0.28
41 0.29
42 0.31
43 0.33
44 0.35
45 0.39
46 0.4
47 0.41
48 0.37
49 0.36
50 0.34
51 0.32
52 0.35
53 0.37
54 0.41
55 0.4
56 0.47
57 0.46
58 0.49
59 0.48
60 0.5
61 0.44
62 0.45
63 0.46
64 0.46
65 0.55
66 0.55
67 0.58
68 0.59
69 0.61
70 0.59
71 0.63
72 0.66
73 0.65
74 0.68
75 0.74
76 0.73
77 0.75
78 0.74
79 0.68
80 0.65
81 0.62
82 0.59
83 0.57
84 0.5
85 0.45
86 0.39
87 0.36
88 0.3
89 0.26
90 0.23
91 0.15
92 0.15
93 0.15
94 0.16
95 0.15
96 0.14
97 0.13
98 0.13
99 0.12
100 0.12
101 0.11
102 0.12
103 0.18
104 0.21
105 0.3
106 0.32
107 0.35
108 0.4
109 0.45
110 0.43
111 0.45
112 0.46
113 0.39
114 0.41
115 0.38
116 0.4
117 0.35
118 0.35
119 0.31
120 0.3
121 0.28
122 0.25
123 0.24
124 0.18
125 0.19
126 0.18
127 0.15
128 0.12
129 0.12
130 0.14
131 0.16
132 0.16
133 0.15
134 0.13
135 0.13
136 0.13
137 0.12
138 0.12
139 0.1
140 0.09
141 0.09
142 0.11
143 0.11
144 0.1
145 0.09
146 0.08
147 0.07
148 0.07
149 0.06
150 0.04
151 0.05
152 0.06
153 0.07
154 0.1
155 0.1
156 0.11
157 0.15
158 0.19
159 0.21
160 0.22
161 0.21
162 0.22
163 0.23
164 0.24
165 0.25
166 0.28
167 0.3
168 0.3
169 0.3
170 0.29
171 0.29
172 0.29
173 0.25
174 0.27
175 0.3
176 0.3
177 0.31
178 0.33
179 0.31
180 0.31
181 0.3
182 0.25
183 0.17
184 0.16
185 0.13
186 0.1
187 0.1
188 0.12
189 0.1
190 0.07
191 0.06
192 0.07
193 0.1
194 0.1
195 0.15
196 0.17
197 0.18
198 0.2
199 0.2
200 0.2
201 0.17
202 0.16
203 0.13
204 0.1
205 0.09
206 0.07
207 0.06
208 0.05
209 0.05
210 0.06
211 0.04
212 0.04
213 0.04
214 0.03
215 0.04
216 0.06
217 0.07
218 0.07
219 0.1
220 0.12
221 0.14
222 0.16
223 0.19
224 0.2
225 0.23
226 0.27
227 0.29
228 0.31
229 0.34
230 0.38
231 0.43
232 0.46
233 0.48
234 0.45
235 0.43
236 0.42
237 0.38
238 0.34
239 0.28
240 0.24
241 0.18
242 0.17
243 0.15
244 0.13
245 0.12
246 0.1
247 0.08
248 0.07
249 0.08
250 0.08
251 0.08
252 0.09
253 0.09
254 0.09
255 0.08
256 0.07
257 0.07
258 0.08
259 0.08
260 0.07
261 0.06
262 0.07
263 0.06
264 0.07
265 0.1
266 0.1
267 0.12
268 0.12
269 0.12
270 0.13
271 0.15
272 0.16
273 0.16
274 0.15
275 0.15
276 0.17
277 0.18
278 0.19
279 0.17
280 0.16
281 0.17
282 0.16
283 0.16
284 0.15
285 0.15
286 0.14
287 0.14
288 0.16
289 0.16
290 0.17
291 0.16
292 0.18
293 0.23
294 0.3
295 0.38
296 0.45
297 0.46
298 0.53
299 0.64
300 0.67
301 0.67
302 0.67
303 0.65
304 0.63
305 0.66
306 0.6
307 0.52
308 0.51
309 0.46
310 0.39
311 0.32
312 0.24
313 0.17
314 0.16
315 0.16
316 0.18
317 0.25
318 0.28
319 0.31
320 0.38
321 0.44
322 0.53
323 0.58
324 0.54
325 0.51
326 0.53
327 0.56
328 0.55
329 0.5
330 0.42
331 0.35
332 0.31
333 0.27
334 0.2
335 0.14
336 0.09
337 0.08
338 0.07
339 0.06
340 0.05
341 0.06
342 0.07
343 0.07
344 0.09
345 0.08
346 0.08
347 0.08
348 0.09
349 0.1
350 0.1
351 0.1
352 0.13
353 0.13
354 0.13
355 0.14
356 0.14
357 0.13
358 0.14
359 0.15
360 0.13
361 0.21
362 0.21
363 0.23
364 0.23
365 0.23
366 0.21
367 0.2
368 0.21
369 0.13
370 0.13
371 0.13
372 0.13
373 0.14
374 0.18
375 0.21
376 0.21
377 0.2
378 0.2
379 0.18
380 0.18
381 0.21
382 0.26
383 0.29
384 0.36
385 0.36
386 0.39
387 0.46
388 0.55
389 0.61
390 0.63
391 0.68
392 0.69
393 0.79
394 0.85
395 0.87
396 0.88
397 0.87
398 0.85
399 0.79
400 0.73
401 0.64
402 0.55
403 0.47
404 0.37
405 0.27
406 0.17
407 0.11
408 0.08
409 0.07
410 0.05
411 0.04
412 0.03
413 0.03
414 0.03
415 0.03
416 0.03
417 0.03
418 0.03
419 0.03
420 0.03
421 0.03
422 0.03
423 0.03
424 0.03
425 0.03
426 0.03
427 0.03
428 0.03
429 0.04
430 0.03
431 0.03
432 0.04
433 0.05
434 0.06
435 0.08
436 0.1
437 0.1
438 0.11
439 0.12
440 0.14
441 0.15
442 0.18
443 0.26
444 0.35
445 0.39
446 0.4
447 0.43
448 0.51
449 0.59
450 0.66
451 0.66
452 0.66
453 0.71
454 0.8
455 0.82
456 0.77
457 0.75
458 0.7
459 0.71
460 0.64
461 0.55
462 0.48
463 0.49
464 0.53
465 0.57
466 0.6
467 0.58
468 0.63
469 0.67
470 0.67
471 0.66
472 0.59
473 0.49
474 0.42
475 0.35
476 0.28
477 0.23
478 0.2
479 0.12
480 0.1
481 0.09
482 0.07
483 0.06
484 0.05
485 0.06
486 0.07
487 0.09
488 0.11
489 0.12
490 0.13
491 0.13
492 0.12
493 0.12
494 0.11
495 0.09
496 0.07
497 0.08
498 0.07
499 0.07
500 0.09
501 0.1
502 0.11
503 0.18
504 0.21
505 0.27
506 0.33
507 0.42
508 0.47
509 0.49
510 0.49
511 0.47
512 0.45
513 0.43
514 0.4
515 0.35
516 0.28
517 0.27
518 0.26
519 0.24
520 0.27
521 0.25
522 0.23
523 0.19
524 0.23
525 0.23
526 0.23
527 0.21
528 0.16
529 0.13
530 0.12
531 0.11
532 0.07
533 0.06
534 0.06
535 0.06
536 0.06
537 0.06
538 0.06
539 0.06
540 0.05
541 0.05
542 0.04
543 0.04
544 0.04
545 0.06
546 0.06
547 0.06
548 0.07
549 0.1
550 0.15
551 0.23
552 0.28
553 0.31
554 0.37
555 0.46
556 0.57
557 0.64
558 0.71
559 0.73
560 0.78
561 0.84
562 0.82
563 0.81
564 0.77
565 0.77
566 0.74
567 0.71
568 0.64
569 0.62
570 0.65
571 0.59
572 0.55
573 0.47
574 0.4
575 0.36
576 0.34
577 0.26
578 0.2
579 0.23
580 0.23
581 0.21
582 0.21
583 0.18
584 0.17
585 0.17
586 0.17
587 0.12
588 0.09
589 0.1
590 0.1
591 0.11
592 0.18
593 0.2
594 0.21
595 0.24
596 0.29
597 0.36
598 0.4
599 0.44
600 0.45
601 0.53
602 0.58
603 0.61
604 0.65
605 0.6
606 0.62
607 0.6
608 0.6
609 0.55
610 0.52
611 0.51
612 0.51
613 0.54
614 0.53
615 0.55
616 0.56
617 0.54
618 0.52
619 0.53
620 0.45
621 0.41