Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074X421

Protein Details
Accession A0A074X421   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22HYEYQNGKSRKRSNLPKQSTEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
IPR008422  Homeobox_KN_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05920  Homeobox_KN  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences HYEYQNGKSRKRSNLPKQSTEIMKRWFDENMHNPYPSEEQKRHFAAVAGINLTQVSNWFINHRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.8
4 0.77
5 0.73
6 0.7
7 0.65
8 0.6
9 0.55
10 0.49
11 0.44
12 0.41
13 0.36
14 0.3
15 0.32
16 0.32
17 0.34
18 0.33
19 0.32
20 0.31
21 0.31
22 0.34
23 0.31
24 0.32
25 0.27
26 0.29
27 0.35
28 0.37
29 0.36
30 0.32
31 0.28
32 0.25
33 0.26
34 0.24
35 0.2
36 0.17
37 0.16
38 0.16
39 0.15
40 0.11
41 0.08
42 0.1
43 0.1
44 0.11
45 0.17