Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TT25

Protein Details
Accession A7TT25   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-51MPQKALKVTKKSKDPRRVTKKQKNLRKAAPIQIKSKKKNLQHLKKLNKTASHydrophilic
NLS Segment(s)
PositionSequence
7-45KVTKKSKDPRRVTKKQKNLRKAAPIQIKSKKKNLQHLKK
78-86EKQKDNKKK
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG vpo:Kpol_337p3  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MPQKALKVTKKSKDPRRVTKKQKNLRKAAPIQIKSKKKNLQHLKKLNKTASLTVATERLISSKVGHLELLKGTRRELEKQKDNKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.91
5 0.91
6 0.92
7 0.92
8 0.92
9 0.92
10 0.9
11 0.89
12 0.86
13 0.84
14 0.79
15 0.77
16 0.77
17 0.71
18 0.7
19 0.7
20 0.71
21 0.66
22 0.69
23 0.67
24 0.62
25 0.68
26 0.71
27 0.72
28 0.74
29 0.79
30 0.8
31 0.8
32 0.81
33 0.72
34 0.66
35 0.58
36 0.49
37 0.42
38 0.34
39 0.28
40 0.22
41 0.21
42 0.17
43 0.15
44 0.13
45 0.11
46 0.09
47 0.09
48 0.1
49 0.12
50 0.14
51 0.14
52 0.15
53 0.15
54 0.16
55 0.19
56 0.23
57 0.24
58 0.23
59 0.24
60 0.29
61 0.32
62 0.38
63 0.45
64 0.5
65 0.55
66 0.65