Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C431

Protein Details
Accession Q6C431    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
184-203AKSTVINKKKPQTNKPAWTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8.5, cyto_mito 7.833, cyto_nucl 6.833, nucl 6.5, cyto 6, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000608  UBQ-conjugat_E2  
IPR016135  UBQ-conjugating_enzyme/RWD  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0061631  F:ubiquitin conjugating enzyme activity  
GO:0000209  P:protein polyubiquitination  
GO:0030433  P:ubiquitin-dependent ERAD pathway  
KEGG yli:YALI0E30173g  -  
Pfam View protein in Pfam  
PF00179  UQ_con  
PROSITE View protein in PROSITE  
PS50127  UBC_2  
CDD cd00195  UBCc  
Amino Acid Sequences MATKAANKRLVKEYASIQENAPPYITAKPAENNLLEWHYLITGPPETPYEGGQYHGVLLFPSEYPFKPPAIKMITPSGRFLPNTRLCLSISDYHPDTWNPAWTVSTILTGLLSFMTSDEHTAGSMTSTEATKRTYASESRRWNLHDKSFQTHFGGTKEAEPAPFVPPRRIPVVEAEGSSTDSLAKSTVINKKKPQTNKPAWTLQQKLLVVLAVILAWIVAARFLGKTAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.42
4 0.36
5 0.36
6 0.36
7 0.33
8 0.27
9 0.2
10 0.18
11 0.2
12 0.21
13 0.17
14 0.19
15 0.21
16 0.24
17 0.28
18 0.26
19 0.25
20 0.26
21 0.26
22 0.23
23 0.21
24 0.18
25 0.14
26 0.13
27 0.12
28 0.11
29 0.11
30 0.1
31 0.11
32 0.12
33 0.13
34 0.14
35 0.14
36 0.15
37 0.14
38 0.15
39 0.15
40 0.14
41 0.13
42 0.13
43 0.12
44 0.08
45 0.08
46 0.08
47 0.07
48 0.08
49 0.1
50 0.1
51 0.15
52 0.16
53 0.18
54 0.19
55 0.19
56 0.25
57 0.28
58 0.29
59 0.27
60 0.35
61 0.39
62 0.37
63 0.39
64 0.34
65 0.31
66 0.31
67 0.3
68 0.31
69 0.3
70 0.33
71 0.32
72 0.31
73 0.29
74 0.3
75 0.31
76 0.27
77 0.23
78 0.23
79 0.23
80 0.22
81 0.23
82 0.21
83 0.21
84 0.16
85 0.18
86 0.14
87 0.13
88 0.13
89 0.12
90 0.14
91 0.11
92 0.1
93 0.07
94 0.07
95 0.06
96 0.06
97 0.05
98 0.04
99 0.04
100 0.03
101 0.03
102 0.04
103 0.04
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.04
113 0.05
114 0.05
115 0.06
116 0.07
117 0.08
118 0.09
119 0.09
120 0.11
121 0.13
122 0.19
123 0.25
124 0.33
125 0.38
126 0.4
127 0.43
128 0.44
129 0.48
130 0.48
131 0.49
132 0.47
133 0.43
134 0.46
135 0.46
136 0.45
137 0.4
138 0.37
139 0.31
140 0.25
141 0.24
142 0.19
143 0.18
144 0.19
145 0.17
146 0.15
147 0.15
148 0.15
149 0.16
150 0.2
151 0.2
152 0.22
153 0.24
154 0.27
155 0.31
156 0.31
157 0.29
158 0.3
159 0.34
160 0.31
161 0.28
162 0.27
163 0.22
164 0.23
165 0.21
166 0.15
167 0.1
168 0.09
169 0.09
170 0.08
171 0.08
172 0.08
173 0.15
174 0.24
175 0.31
176 0.38
177 0.46
178 0.54
179 0.62
180 0.71
181 0.73
182 0.75
183 0.79
184 0.81
185 0.79
186 0.79
187 0.78
188 0.77
189 0.73
190 0.66
191 0.63
192 0.55
193 0.49
194 0.4
195 0.33
196 0.24
197 0.19
198 0.14
199 0.06
200 0.05
201 0.04
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.05
209 0.05