Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074XMJ2

Protein Details
Accession A0A074XMJ2    Localization Confidence High Confidence Score 27
NoLS Segment(s)
PositionSequenceProtein Nature
2-22SSMRNAVQRRNHKERAQPLERHydrophilic
31-61HKDYSLRAKDHNEKKRRLKVLREKVAQRNPDBasic
206-233DTKGLSKEEIRQRRKKRRAQEVLQNQLGHydrophilic
NLS Segment(s)
PositionSequence
37-52RAKDHNEKKRRLKVLR
216-223RQRRKKRR
271-277KVRERKR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MSSMRNAVQRRNHKERAQPLERQKWGLLEKHKDYSLRAKDHNEKKRRLKVLREKVAQRNPDEFAFGMISRTTKKGVQQSVRGKDNGSQTPMNMDVVKLLKTQDAGYLQTVLQQTRRAREKIERQAVLTATGVDASGVSKRKVFDDNGEEVEEISAQQSDFDDDEDMDLDLDDLADLDDLDGLDDLDGIGGEGSGSEDGKSEDEDSDTKGLSKEEIRQRRKKRRAQEVLQNQLGALKDRERDLSAALSQLEHQRARMNNTVGGVNKEGVKFKVRERKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.82
4 0.78
5 0.78
6 0.79
7 0.8
8 0.77
9 0.71
10 0.63
11 0.59
12 0.57
13 0.55
14 0.53
15 0.52
16 0.54
17 0.55
18 0.57
19 0.51
20 0.51
21 0.54
22 0.53
23 0.51
24 0.51
25 0.54
26 0.61
27 0.7
28 0.76
29 0.76
30 0.76
31 0.8
32 0.85
33 0.86
34 0.84
35 0.85
36 0.85
37 0.87
38 0.87
39 0.85
40 0.83
41 0.83
42 0.84
43 0.79
44 0.72
45 0.64
46 0.57
47 0.49
48 0.43
49 0.32
50 0.26
51 0.22
52 0.17
53 0.15
54 0.13
55 0.14
56 0.13
57 0.15
58 0.15
59 0.16
60 0.21
61 0.28
62 0.36
63 0.41
64 0.48
65 0.56
66 0.62
67 0.63
68 0.59
69 0.51
70 0.48
71 0.49
72 0.43
73 0.38
74 0.31
75 0.27
76 0.29
77 0.29
78 0.25
79 0.18
80 0.14
81 0.13
82 0.13
83 0.14
84 0.12
85 0.12
86 0.11
87 0.12
88 0.12
89 0.13
90 0.13
91 0.13
92 0.13
93 0.14
94 0.13
95 0.16
96 0.17
97 0.15
98 0.15
99 0.19
100 0.21
101 0.26
102 0.32
103 0.29
104 0.31
105 0.39
106 0.47
107 0.51
108 0.57
109 0.51
110 0.47
111 0.49
112 0.45
113 0.38
114 0.28
115 0.18
116 0.1
117 0.09
118 0.08
119 0.05
120 0.04
121 0.04
122 0.07
123 0.08
124 0.09
125 0.1
126 0.11
127 0.13
128 0.16
129 0.17
130 0.18
131 0.22
132 0.24
133 0.24
134 0.24
135 0.22
136 0.19
137 0.18
138 0.13
139 0.08
140 0.06
141 0.05
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.03
180 0.03
181 0.04
182 0.04
183 0.05
184 0.06
185 0.06
186 0.07
187 0.08
188 0.08
189 0.1
190 0.11
191 0.13
192 0.13
193 0.13
194 0.13
195 0.13
196 0.13
197 0.13
198 0.15
199 0.22
200 0.31
201 0.41
202 0.5
203 0.59
204 0.7
205 0.79
206 0.87
207 0.88
208 0.88
209 0.89
210 0.9
211 0.88
212 0.88
213 0.87
214 0.86
215 0.79
216 0.68
217 0.57
218 0.49
219 0.41
220 0.33
221 0.25
222 0.19
223 0.2
224 0.22
225 0.25
226 0.24
227 0.24
228 0.23
229 0.24
230 0.21
231 0.2
232 0.19
233 0.17
234 0.18
235 0.23
236 0.27
237 0.24
238 0.24
239 0.28
240 0.32
241 0.37
242 0.43
243 0.4
244 0.37
245 0.38
246 0.41
247 0.36
248 0.37
249 0.32
250 0.27
251 0.27
252 0.27
253 0.29
254 0.27
255 0.32
256 0.31
257 0.39