Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C9P7

Protein Details
Accession Q6C9P7   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-42WSNEEWTKRRRLVQFKRIQQDSVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 7
Family & Domain DBs
KEGG yli:YALI0D09339g  -  
Amino Acid Sequences MTTRAKLEIQGEIRDMSRNWSNEEWTKRRRLVQFKRIQQDSVIKVEFMPLAFEDYEPGMACVSCIYWDQKGECVITSVDAIYLLEQLVNCKFTIEEKNRIRRNLEGYHPLTVSKQKPSSEDFFKLIMGFPQPKPRNIEKDVKVFPWKTLGLALRKIISKYSATFGTPSHHHYPISKTQVQGIHQQQVQAQQQHAQQSQQAQVQAQQGQQPSQSPAYIRHSQPTPPHLPVYSQYQLTSGSGSPPNLPPVMPRQMPYYVQPGQPPLQTQLPVPQPQTPSSPPSNPYRINAYDGTSSSAVPGASAPGAPSVGATAPLPSSAAPVPGAPVAPGAPPGAPIQQPFPNPPINGMTNHNLPVPQMYYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.27
4 0.3
5 0.28
6 0.32
7 0.33
8 0.38
9 0.43
10 0.52
11 0.56
12 0.57
13 0.64
14 0.64
15 0.7
16 0.73
17 0.77
18 0.78
19 0.8
20 0.82
21 0.82
22 0.86
23 0.81
24 0.72
25 0.67
26 0.64
27 0.57
28 0.54
29 0.45
30 0.36
31 0.33
32 0.34
33 0.29
34 0.21
35 0.18
36 0.11
37 0.14
38 0.14
39 0.14
40 0.13
41 0.12
42 0.13
43 0.12
44 0.12
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.09
52 0.11
53 0.13
54 0.16
55 0.18
56 0.2
57 0.22
58 0.22
59 0.2
60 0.19
61 0.17
62 0.14
63 0.14
64 0.11
65 0.09
66 0.08
67 0.08
68 0.06
69 0.07
70 0.06
71 0.06
72 0.06
73 0.08
74 0.1
75 0.11
76 0.1
77 0.1
78 0.1
79 0.13
80 0.24
81 0.27
82 0.36
83 0.44
84 0.54
85 0.59
86 0.62
87 0.61
88 0.56
89 0.57
90 0.53
91 0.5
92 0.49
93 0.45
94 0.45
95 0.43
96 0.38
97 0.33
98 0.35
99 0.32
100 0.31
101 0.33
102 0.31
103 0.34
104 0.38
105 0.42
106 0.4
107 0.4
108 0.35
109 0.31
110 0.3
111 0.28
112 0.23
113 0.18
114 0.17
115 0.18
116 0.18
117 0.28
118 0.3
119 0.33
120 0.39
121 0.43
122 0.47
123 0.48
124 0.56
125 0.5
126 0.56
127 0.55
128 0.52
129 0.52
130 0.45
131 0.4
132 0.35
133 0.31
134 0.23
135 0.24
136 0.25
137 0.22
138 0.24
139 0.24
140 0.22
141 0.23
142 0.23
143 0.2
144 0.17
145 0.15
146 0.14
147 0.16
148 0.15
149 0.14
150 0.14
151 0.14
152 0.16
153 0.16
154 0.2
155 0.22
156 0.22
157 0.22
158 0.23
159 0.28
160 0.32
161 0.38
162 0.34
163 0.3
164 0.33
165 0.35
166 0.35
167 0.38
168 0.33
169 0.31
170 0.29
171 0.3
172 0.27
173 0.3
174 0.32
175 0.26
176 0.23
177 0.22
178 0.24
179 0.28
180 0.27
181 0.22
182 0.2
183 0.21
184 0.24
185 0.22
186 0.21
187 0.16
188 0.19
189 0.21
190 0.22
191 0.21
192 0.21
193 0.2
194 0.2
195 0.2
196 0.18
197 0.17
198 0.16
199 0.15
200 0.13
201 0.17
202 0.23
203 0.28
204 0.27
205 0.29
206 0.3
207 0.33
208 0.37
209 0.39
210 0.37
211 0.34
212 0.35
213 0.31
214 0.31
215 0.29
216 0.32
217 0.28
218 0.23
219 0.21
220 0.2
221 0.2
222 0.19
223 0.19
224 0.11
225 0.12
226 0.14
227 0.14
228 0.16
229 0.16
230 0.18
231 0.17
232 0.17
233 0.15
234 0.2
235 0.26
236 0.25
237 0.25
238 0.26
239 0.29
240 0.31
241 0.31
242 0.31
243 0.29
244 0.29
245 0.3
246 0.3
247 0.3
248 0.3
249 0.29
250 0.26
251 0.25
252 0.24
253 0.23
254 0.26
255 0.29
256 0.32
257 0.32
258 0.33
259 0.32
260 0.34
261 0.39
262 0.34
263 0.34
264 0.36
265 0.38
266 0.36
267 0.41
268 0.47
269 0.44
270 0.44
271 0.45
272 0.42
273 0.42
274 0.4
275 0.36
276 0.31
277 0.29
278 0.31
279 0.24
280 0.22
281 0.18
282 0.17
283 0.14
284 0.11
285 0.11
286 0.08
287 0.08
288 0.08
289 0.08
290 0.08
291 0.08
292 0.08
293 0.07
294 0.07
295 0.07
296 0.08
297 0.08
298 0.08
299 0.08
300 0.09
301 0.09
302 0.08
303 0.11
304 0.1
305 0.12
306 0.11
307 0.11
308 0.13
309 0.13
310 0.13
311 0.1
312 0.11
313 0.1
314 0.1
315 0.11
316 0.1
317 0.09
318 0.11
319 0.13
320 0.16
321 0.17
322 0.18
323 0.22
324 0.27
325 0.3
326 0.33
327 0.36
328 0.38
329 0.37
330 0.38
331 0.39
332 0.36
333 0.36
334 0.37
335 0.38
336 0.36
337 0.37
338 0.35
339 0.3
340 0.28
341 0.29