Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C1V5

Protein Details
Accession Q6C1V5    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-59SVPLKHRSWERRQKERENLRMIHydrophilic
98-123TAILSAKKLARRKRKEKRNKLLRERNBasic
NLS Segment(s)
PositionSequence
42-123KHRSWERRQKERENLRMIKAKEKEMKDEKEAEHAEKVRRIKERRMAKEEKERLEKMTAILSAKKLARRKRKEKRNKLLRERN
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG yli:YALI0F13101g  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSEQEEVQLPKLGKAPQVRVNGKNWKETKTPFRTSSLSVPLKHRSWERRQKERENLRMIKAKEKEMKDEKEAEHAEKVRRIKERRMAKEEKERLEKMTAILSAKKLARRKRKEKRNKLLRERN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.41
4 0.51
5 0.55
6 0.54
7 0.59
8 0.64
9 0.6
10 0.63
11 0.58
12 0.53
13 0.53
14 0.55
15 0.58
16 0.56
17 0.61
18 0.54
19 0.56
20 0.53
21 0.51
22 0.5
23 0.49
24 0.45
25 0.4
26 0.42
27 0.44
28 0.42
29 0.42
30 0.44
31 0.43
32 0.49
33 0.57
34 0.61
35 0.66
36 0.73
37 0.78
38 0.81
39 0.83
40 0.8
41 0.79
42 0.73
43 0.67
44 0.66
45 0.58
46 0.56
47 0.48
48 0.46
49 0.43
50 0.41
51 0.44
52 0.45
53 0.47
54 0.42
55 0.44
56 0.38
57 0.38
58 0.39
59 0.33
60 0.3
61 0.3
62 0.3
63 0.31
64 0.34
65 0.32
66 0.4
67 0.42
68 0.46
69 0.51
70 0.59
71 0.63
72 0.68
73 0.69
74 0.68
75 0.75
76 0.74
77 0.73
78 0.7
79 0.63
80 0.57
81 0.53
82 0.47
83 0.37
84 0.33
85 0.27
86 0.22
87 0.24
88 0.22
89 0.24
90 0.27
91 0.33
92 0.37
93 0.45
94 0.54
95 0.62
96 0.72
97 0.78
98 0.86
99 0.91
100 0.94
101 0.95
102 0.95
103 0.96