Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074WLP6

Protein Details
Accession A0A074WLP6   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28GGQTKAACLPCRKRKSKCDGDRPSCKCCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences GGQTKAACLPCRKRKSKCDGDRPSCKCCMAKATMCNYSVTTPGVTQQQAIKNELDAYKRVLTLIRDSSSSDVESLVRIIKARNSLNDAVQDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.88
4 0.88
5 0.88
6 0.89
7 0.89
8 0.9
9 0.85
10 0.8
11 0.72
12 0.64
13 0.54
14 0.45
15 0.41
16 0.37
17 0.37
18 0.38
19 0.4
20 0.42
21 0.41
22 0.4
23 0.35
24 0.3
25 0.25
26 0.2
27 0.14
28 0.1
29 0.11
30 0.13
31 0.12
32 0.12
33 0.14
34 0.19
35 0.2
36 0.22
37 0.2
38 0.18
39 0.2
40 0.21
41 0.19
42 0.15
43 0.17
44 0.16
45 0.16
46 0.16
47 0.16
48 0.16
49 0.19
50 0.23
51 0.2
52 0.2
53 0.21
54 0.22
55 0.22
56 0.21
57 0.16
58 0.12
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1
64 0.11
65 0.12
66 0.16
67 0.23
68 0.26
69 0.29
70 0.34
71 0.36
72 0.38