Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074WJT0

Protein Details
Accession A0A074WJT0    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
46-67AQDNKPNKKFPNKPVKPQPLIFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019095  Mediator_Med18  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF09637  Med18  
Amino Acid Sequences MHELLLYGQVPLERHDQVLKILAGIAAMQPQTLFERRLIYRPMRSAQDNKPNKKFPNKPVKPQPLIFQHLVRQVDQSEFGKDSEVLLESETNANASRPAYTWRIKTQETPEPEIKTIILRQATDTVLDTDQLRVFLDPTNNGFVNEFFIEGHRFVHKNMVLTLFRLLRAGDTPQQTPLTTLPPLESLSPLDVSGAFVLEACVRIDDRTKPHLVSTASDELSAFKDLMKGSVDMKVPERLSLDTRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.22
4 0.22
5 0.26
6 0.24
7 0.19
8 0.19
9 0.17
10 0.14
11 0.13
12 0.12
13 0.09
14 0.09
15 0.09
16 0.08
17 0.09
18 0.14
19 0.16
20 0.17
21 0.16
22 0.22
23 0.24
24 0.3
25 0.35
26 0.37
27 0.41
28 0.45
29 0.48
30 0.47
31 0.51
32 0.53
33 0.56
34 0.6
35 0.63
36 0.67
37 0.71
38 0.74
39 0.75
40 0.78
41 0.78
42 0.78
43 0.79
44 0.78
45 0.79
46 0.83
47 0.86
48 0.81
49 0.74
50 0.71
51 0.67
52 0.66
53 0.58
54 0.49
55 0.43
56 0.43
57 0.42
58 0.35
59 0.29
60 0.24
61 0.23
62 0.24
63 0.2
64 0.17
65 0.16
66 0.16
67 0.15
68 0.14
69 0.13
70 0.11
71 0.11
72 0.09
73 0.08
74 0.08
75 0.08
76 0.09
77 0.08
78 0.08
79 0.07
80 0.07
81 0.08
82 0.08
83 0.08
84 0.08
85 0.11
86 0.16
87 0.19
88 0.22
89 0.26
90 0.31
91 0.31
92 0.35
93 0.37
94 0.38
95 0.39
96 0.42
97 0.4
98 0.38
99 0.37
100 0.33
101 0.28
102 0.22
103 0.19
104 0.17
105 0.14
106 0.12
107 0.12
108 0.14
109 0.14
110 0.13
111 0.12
112 0.1
113 0.09
114 0.1
115 0.09
116 0.08
117 0.09
118 0.08
119 0.08
120 0.07
121 0.07
122 0.09
123 0.1
124 0.1
125 0.11
126 0.14
127 0.14
128 0.14
129 0.14
130 0.12
131 0.13
132 0.12
133 0.11
134 0.08
135 0.09
136 0.1
137 0.1
138 0.11
139 0.12
140 0.12
141 0.12
142 0.2
143 0.2
144 0.2
145 0.21
146 0.25
147 0.22
148 0.22
149 0.25
150 0.19
151 0.18
152 0.17
153 0.15
154 0.11
155 0.12
156 0.15
157 0.17
158 0.19
159 0.19
160 0.22
161 0.23
162 0.22
163 0.23
164 0.21
165 0.19
166 0.17
167 0.16
168 0.14
169 0.14
170 0.15
171 0.14
172 0.14
173 0.12
174 0.13
175 0.13
176 0.12
177 0.11
178 0.1
179 0.1
180 0.09
181 0.08
182 0.06
183 0.05
184 0.06
185 0.06
186 0.07
187 0.07
188 0.08
189 0.08
190 0.09
191 0.13
192 0.18
193 0.23
194 0.28
195 0.32
196 0.31
197 0.32
198 0.37
199 0.35
200 0.32
201 0.34
202 0.34
203 0.31
204 0.3
205 0.28
206 0.24
207 0.24
208 0.23
209 0.16
210 0.1
211 0.13
212 0.13
213 0.15
214 0.16
215 0.15
216 0.15
217 0.21
218 0.23
219 0.22
220 0.25
221 0.3
222 0.29
223 0.3
224 0.31
225 0.28
226 0.3