Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074WNG2

Protein Details
Accession A0A074WNG2   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30KRRQTLAACRPCRKRKSKCDGARPRCNTCIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences KRRQTLAACRPCRKRKSKCDGARPRCNTCIDKATPCVFSVEEGKTQQQASREELKAYRSVVCMLRRASPPATEAILRHLRQHDDVNEAVKFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.88
4 0.9
5 0.9
6 0.91
7 0.92
8 0.92
9 0.92
10 0.87
11 0.83
12 0.76
13 0.72
14 0.63
15 0.56
16 0.53
17 0.46
18 0.42
19 0.41
20 0.38
21 0.34
22 0.32
23 0.29
24 0.21
25 0.19
26 0.19
27 0.16
28 0.16
29 0.16
30 0.16
31 0.16
32 0.17
33 0.17
34 0.17
35 0.18
36 0.2
37 0.26
38 0.25
39 0.26
40 0.27
41 0.27
42 0.26
43 0.25
44 0.22
45 0.16
46 0.18
47 0.22
48 0.23
49 0.25
50 0.25
51 0.29
52 0.29
53 0.32
54 0.31
55 0.28
56 0.27
57 0.24
58 0.25
59 0.21
60 0.19
61 0.23
62 0.29
63 0.29
64 0.33
65 0.34
66 0.36
67 0.37
68 0.44
69 0.38
70 0.35
71 0.36
72 0.35