Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074WRX3

Protein Details
Accession A0A074WRX3    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
240-259EPPKSTPRSSAKKRKQPLTDHydrophilic
352-385IPQAQTPKKNKPPAKTPLHRKEKHAPRPVAKDAEHydrophilic
NLS Segment(s)
PositionSequence
250-253AKKR
359-379KKNKPPAKTPLHRKEKHAPRP
Subcellular Location(s) nucl 11, cyto_nucl 10, cyto 7, extr 4, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008721  ORC6  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003677  F:DNA binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF05460  ORC6  
Amino Acid Sequences MPTPIEQALITLVPTLNSLPQELIDLSTSLLAQSRNKASSLKPEEEIGRTYACAHIAVERLKPRLDIDKVVARPPVAPRIYKKLYGYLDTSLKEPATPRTNRLKDVETVGTPGSGRGRRSAADTPSKTPAKTVKSAGATPSKTPASVAKSVGSVTTSGRRTRSAFKAPEAKDEATVQDSEEERQKEAAQQEEKDDSLPDQVRPMAEAVCDALDVPQATPHVCAALSAILHLRGWNDTKSEPPKSTPRSSAKKRKQPLTDTIDVAAIEDPSSITPTSLPALIAAVSLVTTFTLRNTVIDGTTYATARSSTITALEPNGPLPIDVDTFLHASKAEGWLELPWFTTVKASTITSIPQAQTPKKNKPPAKTPLHRKEKHAPRPVAKDAEMDIVMEDVDAEAEEEDNDRPGAGLRSGLGTMFQDSVDWLSGERRKAYRSWEQSVRERCAQIQGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.13
5 0.14
6 0.13
7 0.13
8 0.15
9 0.15
10 0.15
11 0.13
12 0.13
13 0.12
14 0.12
15 0.12
16 0.1
17 0.12
18 0.13
19 0.15
20 0.22
21 0.28
22 0.29
23 0.3
24 0.33
25 0.34
26 0.42
27 0.46
28 0.44
29 0.39
30 0.41
31 0.44
32 0.43
33 0.42
34 0.34
35 0.27
36 0.23
37 0.23
38 0.21
39 0.18
40 0.16
41 0.14
42 0.15
43 0.19
44 0.21
45 0.26
46 0.3
47 0.32
48 0.32
49 0.33
50 0.32
51 0.36
52 0.37
53 0.34
54 0.35
55 0.4
56 0.41
57 0.44
58 0.42
59 0.34
60 0.34
61 0.34
62 0.38
63 0.33
64 0.36
65 0.37
66 0.45
67 0.49
68 0.5
69 0.48
70 0.47
71 0.47
72 0.46
73 0.43
74 0.39
75 0.39
76 0.35
77 0.34
78 0.28
79 0.24
80 0.22
81 0.21
82 0.24
83 0.28
84 0.3
85 0.36
86 0.45
87 0.48
88 0.51
89 0.53
90 0.49
91 0.43
92 0.46
93 0.43
94 0.33
95 0.31
96 0.27
97 0.24
98 0.2
99 0.19
100 0.2
101 0.2
102 0.2
103 0.22
104 0.24
105 0.24
106 0.29
107 0.34
108 0.34
109 0.4
110 0.42
111 0.42
112 0.49
113 0.5
114 0.44
115 0.42
116 0.43
117 0.38
118 0.4
119 0.39
120 0.37
121 0.38
122 0.4
123 0.4
124 0.41
125 0.37
126 0.33
127 0.36
128 0.3
129 0.26
130 0.26
131 0.26
132 0.24
133 0.26
134 0.26
135 0.22
136 0.22
137 0.22
138 0.21
139 0.17
140 0.12
141 0.11
142 0.16
143 0.18
144 0.2
145 0.22
146 0.25
147 0.27
148 0.33
149 0.39
150 0.41
151 0.41
152 0.43
153 0.51
154 0.5
155 0.53
156 0.51
157 0.44
158 0.37
159 0.35
160 0.31
161 0.23
162 0.22
163 0.15
164 0.13
165 0.13
166 0.13
167 0.18
168 0.18
169 0.17
170 0.18
171 0.18
172 0.19
173 0.2
174 0.26
175 0.23
176 0.23
177 0.25
178 0.25
179 0.25
180 0.21
181 0.2
182 0.13
183 0.16
184 0.16
185 0.14
186 0.14
187 0.14
188 0.14
189 0.14
190 0.14
191 0.09
192 0.08
193 0.08
194 0.07
195 0.06
196 0.06
197 0.05
198 0.04
199 0.05
200 0.05
201 0.05
202 0.06
203 0.06
204 0.07
205 0.07
206 0.07
207 0.06
208 0.06
209 0.06
210 0.05
211 0.06
212 0.05
213 0.05
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.07
220 0.09
221 0.09
222 0.11
223 0.11
224 0.17
225 0.22
226 0.25
227 0.25
228 0.27
229 0.35
230 0.4
231 0.43
232 0.46
233 0.49
234 0.55
235 0.64
236 0.71
237 0.73
238 0.76
239 0.8
240 0.8
241 0.79
242 0.75
243 0.74
244 0.71
245 0.64
246 0.56
247 0.49
248 0.41
249 0.33
250 0.28
251 0.19
252 0.11
253 0.07
254 0.06
255 0.06
256 0.05
257 0.06
258 0.06
259 0.06
260 0.06
261 0.07
262 0.08
263 0.08
264 0.08
265 0.06
266 0.06
267 0.06
268 0.06
269 0.05
270 0.04
271 0.03
272 0.03
273 0.03
274 0.03
275 0.03
276 0.04
277 0.04
278 0.07
279 0.07
280 0.07
281 0.09
282 0.1
283 0.09
284 0.1
285 0.1
286 0.09
287 0.11
288 0.11
289 0.09
290 0.09
291 0.09
292 0.09
293 0.09
294 0.08
295 0.07
296 0.09
297 0.1
298 0.1
299 0.12
300 0.13
301 0.12
302 0.12
303 0.12
304 0.11
305 0.1
306 0.09
307 0.09
308 0.08
309 0.08
310 0.09
311 0.09
312 0.1
313 0.1
314 0.1
315 0.08
316 0.08
317 0.09
318 0.12
319 0.11
320 0.1
321 0.11
322 0.12
323 0.13
324 0.12
325 0.12
326 0.1
327 0.1
328 0.1
329 0.12
330 0.11
331 0.11
332 0.13
333 0.13
334 0.13
335 0.14
336 0.15
337 0.16
338 0.19
339 0.18
340 0.2
341 0.26
342 0.31
343 0.4
344 0.47
345 0.54
346 0.61
347 0.7
348 0.73
349 0.75
350 0.78
351 0.78
352 0.81
353 0.81
354 0.83
355 0.83
356 0.88
357 0.84
358 0.82
359 0.82
360 0.82
361 0.83
362 0.82
363 0.8
364 0.77
365 0.81
366 0.81
367 0.76
368 0.66
369 0.58
370 0.49
371 0.45
372 0.36
373 0.28
374 0.21
375 0.15
376 0.13
377 0.1
378 0.08
379 0.04
380 0.04
381 0.04
382 0.04
383 0.04
384 0.04
385 0.05
386 0.07
387 0.07
388 0.09
389 0.09
390 0.08
391 0.08
392 0.1
393 0.12
394 0.12
395 0.12
396 0.11
397 0.14
398 0.14
399 0.14
400 0.13
401 0.11
402 0.13
403 0.13
404 0.12
405 0.1
406 0.1
407 0.12
408 0.12
409 0.11
410 0.1
411 0.17
412 0.22
413 0.26
414 0.31
415 0.33
416 0.35
417 0.39
418 0.46
419 0.49
420 0.53
421 0.58
422 0.6
423 0.64
424 0.7
425 0.76
426 0.75
427 0.7
428 0.65
429 0.58
430 0.6