Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XTQ8

Protein Details
Accession A0A074XTQ8   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
29-58EEDLSTKPRCQRCRKSKKGCDRQRPCGRCKBasic
NLS Segment(s)
PositionSequence
120-126KNKKRKR
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSPASLPSHSRKTSTASTINFQHQLGIDEEDLSTKPRCQRCRKSKKGCDRQRPCGRCKDAGIGIEGCVSEDEGNGRKGRYGRHMGVPVKKSDLGYDTYDTVPITAAGGTGEFLAPALPDKNKKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.41
4 0.43
5 0.45
6 0.48
7 0.44
8 0.38
9 0.33
10 0.27
11 0.26
12 0.23
13 0.21
14 0.16
15 0.14
16 0.14
17 0.13
18 0.13
19 0.13
20 0.13
21 0.14
22 0.21
23 0.28
24 0.38
25 0.47
26 0.58
27 0.67
28 0.77
29 0.85
30 0.89
31 0.91
32 0.93
33 0.94
34 0.93
35 0.93
36 0.9
37 0.9
38 0.9
39 0.85
40 0.79
41 0.77
42 0.71
43 0.63
44 0.56
45 0.5
46 0.42
47 0.36
48 0.34
49 0.24
50 0.19
51 0.17
52 0.15
53 0.1
54 0.07
55 0.07
56 0.05
57 0.04
58 0.06
59 0.07
60 0.1
61 0.1
62 0.11
63 0.13
64 0.15
65 0.18
66 0.24
67 0.29
68 0.3
69 0.35
70 0.42
71 0.45
72 0.51
73 0.51
74 0.45
75 0.41
76 0.4
77 0.34
78 0.29
79 0.26
80 0.22
81 0.22
82 0.22
83 0.21
84 0.19
85 0.2
86 0.18
87 0.16
88 0.13
89 0.1
90 0.08
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.06
97 0.05
98 0.04
99 0.05
100 0.05
101 0.05
102 0.07
103 0.1
104 0.15
105 0.25
106 0.35