Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C7Y3

Protein Details
Accession Q6C7Y3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
59-82FVIYRVRVRRGNRKRPSKKGATYGHydrophilic
NLS Segment(s)
PositionSequence
37-78HRASRPSRPDKARRLGYKAKQGFVIYRVRVRRGNRKRPSKKG
169-173KKNRG
Subcellular Location(s) mito 14, nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024794  Rbsml_L15e_core_dom_sf  
IPR000439  Ribosomal_L15e  
IPR020925  Ribosomal_L15e_CS  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG yli:YALI0D24387g  -  
Pfam View protein in Pfam  
PF00827  Ribosomal_L15e  
PROSITE View protein in PROSITE  
PS01194  RIBOSOMAL_L15E  
Amino Acid Sequences MGAYKYLEEIHRKKQSDVLRFLLRVRCWEYRQKTGIHRASRPSRPDKARRLGYKAKQGFVIYRVRVRRGNRKRPSKKGATYGKPTNQGINQLKLQRSLRAVAEERVGRRAGNLRVLNSYWVNQDSTYKYFEVILVDPSHVVIRNDPRINWICNPVHKHRESRGLTAAGKKNRGINKGHKYHNTSAGRRHTWKLQNTLSLWRYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.6
4 0.61
5 0.58
6 0.55
7 0.54
8 0.57
9 0.57
10 0.49
11 0.45
12 0.46
13 0.45
14 0.44
15 0.53
16 0.54
17 0.56
18 0.58
19 0.59
20 0.6
21 0.64
22 0.68
23 0.64
24 0.63
25 0.63
26 0.68
27 0.7
28 0.7
29 0.67
30 0.68
31 0.7
32 0.75
33 0.75
34 0.76
35 0.78
36 0.76
37 0.76
38 0.77
39 0.74
40 0.76
41 0.7
42 0.62
43 0.55
44 0.5
45 0.44
46 0.39
47 0.39
48 0.31
49 0.33
50 0.35
51 0.36
52 0.41
53 0.44
54 0.51
55 0.55
56 0.64
57 0.67
58 0.75
59 0.81
60 0.85
61 0.88
62 0.86
63 0.81
64 0.8
65 0.79
66 0.75
67 0.73
68 0.7
69 0.66
70 0.61
71 0.56
72 0.5
73 0.41
74 0.43
75 0.39
76 0.34
77 0.33
78 0.32
79 0.32
80 0.34
81 0.34
82 0.27
83 0.26
84 0.25
85 0.21
86 0.21
87 0.22
88 0.18
89 0.2
90 0.2
91 0.19
92 0.19
93 0.19
94 0.15
95 0.15
96 0.19
97 0.17
98 0.23
99 0.24
100 0.23
101 0.25
102 0.25
103 0.26
104 0.22
105 0.21
106 0.15
107 0.15
108 0.14
109 0.12
110 0.15
111 0.16
112 0.17
113 0.18
114 0.17
115 0.16
116 0.16
117 0.16
118 0.15
119 0.13
120 0.13
121 0.12
122 0.12
123 0.11
124 0.11
125 0.12
126 0.11
127 0.11
128 0.12
129 0.18
130 0.26
131 0.28
132 0.27
133 0.33
134 0.36
135 0.39
136 0.37
137 0.38
138 0.34
139 0.39
140 0.46
141 0.47
142 0.52
143 0.53
144 0.57
145 0.54
146 0.61
147 0.58
148 0.57
149 0.54
150 0.49
151 0.48
152 0.51
153 0.54
154 0.5
155 0.5
156 0.47
157 0.49
158 0.51
159 0.53
160 0.51
161 0.54
162 0.58
163 0.63
164 0.69
165 0.7
166 0.71
167 0.73
168 0.75
169 0.74
170 0.68
171 0.68
172 0.7
173 0.69
174 0.66
175 0.65
176 0.65
177 0.65
178 0.68
179 0.68
180 0.64
181 0.64
182 0.61
183 0.66