Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C3Z0

Protein Details
Accession Q6C3Z0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-115QAKQQQCKPTHYNKRPTKQYNKGSNKCGGKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, golg 4, E.R. 3
Family & Domain DBs
KEGG yli:YALI0E31152g  -  
Amino Acid Sequences MLFKKIALFTLAAVAVASPVITDEDIEGLDFADIEHSPEEPADIMKFKQMIHDKKCNILTKKCPQPQQKCNKVTKTVTKVHTKTVQAKQQQCKPTHYNKRPTKQYNKGSNKCGGKGNRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.07
4 0.06
5 0.03
6 0.04
7 0.05
8 0.05
9 0.05
10 0.05
11 0.06
12 0.06
13 0.06
14 0.06
15 0.05
16 0.05
17 0.04
18 0.04
19 0.05
20 0.05
21 0.06
22 0.06
23 0.07
24 0.07
25 0.07
26 0.07
27 0.06
28 0.07
29 0.07
30 0.08
31 0.08
32 0.1
33 0.11
34 0.11
35 0.18
36 0.25
37 0.32
38 0.37
39 0.45
40 0.44
41 0.48
42 0.54
43 0.54
44 0.5
45 0.49
46 0.5
47 0.51
48 0.6
49 0.6
50 0.63
51 0.65
52 0.71
53 0.74
54 0.77
55 0.79
56 0.77
57 0.79
58 0.76
59 0.73
60 0.69
61 0.68
62 0.64
63 0.62
64 0.59
65 0.61
66 0.58
67 0.57
68 0.58
69 0.54
70 0.55
71 0.56
72 0.59
73 0.57
74 0.65
75 0.67
76 0.69
77 0.72
78 0.66
79 0.66
80 0.65
81 0.68
82 0.71
83 0.72
84 0.75
85 0.77
86 0.84
87 0.87
88 0.89
89 0.89
90 0.88
91 0.89
92 0.89
93 0.9
94 0.88
95 0.83
96 0.82
97 0.77
98 0.7
99 0.69