Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XHJ5

Protein Details
Accession A0A074XHJ5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
104-130EDASRVTEKQKKKQTHFPQRNYAVKAQHydrophilic
NLS Segment(s)
PositionSequence
97-101IRRRL
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MVRALSSAKVKASQLWSKNKDELKTQLEELKAELVQLRTQKIAGGAQSKLTRIHDVRKSIARVLTIININQRSQLRIFYKNKKYLPLDLRAKQTRAIRRRLSKEDASRVTEKQKKKQTHFPQRNYAVKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.52
3 0.55
4 0.57
5 0.63
6 0.63
7 0.58
8 0.55
9 0.54
10 0.48
11 0.46
12 0.43
13 0.4
14 0.36
15 0.34
16 0.29
17 0.24
18 0.19
19 0.16
20 0.16
21 0.13
22 0.15
23 0.18
24 0.18
25 0.16
26 0.16
27 0.17
28 0.15
29 0.16
30 0.16
31 0.16
32 0.15
33 0.18
34 0.2
35 0.2
36 0.21
37 0.21
38 0.23
39 0.22
40 0.29
41 0.3
42 0.32
43 0.34
44 0.37
45 0.37
46 0.34
47 0.34
48 0.26
49 0.22
50 0.19
51 0.19
52 0.15
53 0.14
54 0.16
55 0.16
56 0.15
57 0.19
58 0.18
59 0.17
60 0.17
61 0.22
62 0.22
63 0.3
64 0.37
65 0.43
66 0.52
67 0.58
68 0.59
69 0.6
70 0.59
71 0.59
72 0.57
73 0.56
74 0.56
75 0.53
76 0.6
77 0.57
78 0.55
79 0.52
80 0.54
81 0.55
82 0.54
83 0.58
84 0.59
85 0.64
86 0.71
87 0.73
88 0.73
89 0.71
90 0.73
91 0.73
92 0.69
93 0.65
94 0.61
95 0.57
96 0.6
97 0.59
98 0.59
99 0.59
100 0.64
101 0.68
102 0.72
103 0.8
104 0.81
105 0.85
106 0.88
107 0.86
108 0.87
109 0.86
110 0.87