Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074X095

Protein Details
Accession A0A074X095    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
5-35QEQPSRRKDAKTRSRASKACARCRIKKAKCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 14, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSTIQEQPSRRKDAKTRSRASKACARCRIKKAKCTGGSPCSNCQASDAICHFREIKWSRGKMFPAHHVHELEVQQHKLEAAIRIMYFRLLAASSWPAPRLMEHDNKPLIHDVLRALGLLETSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.77
4 0.78
5 0.84
6 0.8
7 0.77
8 0.75
9 0.74
10 0.73
11 0.74
12 0.72
13 0.71
14 0.77
15 0.82
16 0.81
17 0.8
18 0.78
19 0.78
20 0.75
21 0.71
22 0.69
23 0.66
24 0.66
25 0.61
26 0.55
27 0.5
28 0.46
29 0.4
30 0.34
31 0.28
32 0.2
33 0.21
34 0.2
35 0.2
36 0.19
37 0.2
38 0.2
39 0.18
40 0.27
41 0.25
42 0.3
43 0.34
44 0.36
45 0.37
46 0.4
47 0.42
48 0.38
49 0.38
50 0.39
51 0.37
52 0.38
53 0.38
54 0.34
55 0.33
56 0.32
57 0.3
58 0.25
59 0.23
60 0.2
61 0.17
62 0.17
63 0.16
64 0.13
65 0.14
66 0.11
67 0.09
68 0.11
69 0.11
70 0.11
71 0.11
72 0.11
73 0.09
74 0.08
75 0.07
76 0.06
77 0.06
78 0.08
79 0.11
80 0.13
81 0.14
82 0.15
83 0.15
84 0.15
85 0.15
86 0.18
87 0.22
88 0.28
89 0.31
90 0.39
91 0.42
92 0.42
93 0.44
94 0.42
95 0.37
96 0.3
97 0.28
98 0.21
99 0.2
100 0.2
101 0.17
102 0.14
103 0.13