Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074WUK1

Protein Details
Accession A0A074WUK1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-39LKLKGAKPTGVEKKRKKKSSSSKSTAAHydrophilic
NLS Segment(s)
PositionSequence
14-32KLKGAKPTGVEKKRKKKSS
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSSDYTSAGGGLKLKGAKPTGVEKKRKKKSSSSKSTAAAASSSKDASPAKDDTAIPENTTDLEQREKNKEERLVPDDGKTEYERRHEETRRKRLEEKLMREGVKTHKERVEELNKYLSTLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.21
4 0.23
5 0.23
6 0.24
7 0.34
8 0.41
9 0.48
10 0.57
11 0.63
12 0.72
13 0.81
14 0.87
15 0.82
16 0.83
17 0.85
18 0.85
19 0.86
20 0.82
21 0.77
22 0.71
23 0.68
24 0.57
25 0.47
26 0.37
27 0.26
28 0.21
29 0.16
30 0.14
31 0.11
32 0.13
33 0.13
34 0.13
35 0.16
36 0.16
37 0.16
38 0.18
39 0.18
40 0.19
41 0.23
42 0.22
43 0.18
44 0.17
45 0.16
46 0.14
47 0.15
48 0.12
49 0.08
50 0.12
51 0.14
52 0.17
53 0.22
54 0.24
55 0.26
56 0.3
57 0.33
58 0.32
59 0.35
60 0.35
61 0.35
62 0.32
63 0.31
64 0.29
65 0.25
66 0.24
67 0.22
68 0.21
69 0.19
70 0.24
71 0.26
72 0.29
73 0.37
74 0.42
75 0.51
76 0.58
77 0.66
78 0.69
79 0.71
80 0.72
81 0.71
82 0.75
83 0.74
84 0.71
85 0.69
86 0.67
87 0.63
88 0.58
89 0.54
90 0.51
91 0.51
92 0.47
93 0.44
94 0.41
95 0.42
96 0.45
97 0.5
98 0.52
99 0.46
100 0.46
101 0.48
102 0.44
103 0.43
104 0.4
105 0.32
106 0.25
107 0.23
108 0.24
109 0.21
110 0.22
111 0.23
112 0.29
113 0.28