Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074WRG9

Protein Details
Accession A0A074WRG9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-38TEPPRKRQRVTQACHRCRRKKYKCDSERPTCSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSQTATEPPRKRQRVTQACHRCRRKKYKCDSERPTCSTCKASDAECTYGTIAKRRGLQSGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.75
4 0.75
5 0.79
6 0.85
7 0.86
8 0.84
9 0.84
10 0.89
11 0.88
12 0.87
13 0.89
14 0.9
15 0.89
16 0.91
17 0.89
18 0.87
19 0.84
20 0.78
21 0.71
22 0.61
23 0.54
24 0.47
25 0.39
26 0.33
27 0.27
28 0.23
29 0.26
30 0.28
31 0.28
32 0.25
33 0.26
34 0.23
35 0.25
36 0.25
37 0.25
38 0.25
39 0.27
40 0.33
41 0.34