Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C169

Protein Details
Accession Q6C169    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-100KDSSCYRSRRAGERKRKSVRGCBasic
214-236AKRVAEKKSEKAEEKKRRASSLRBasic
NLS Segment(s)
PositionSequence
88-95RAGERKRK
182-197PRRLAHKAQLREKKVK
215-232KRVAEKKSEKAEEKKRRA
Subcellular Location(s) nucl 18.5, cyto_nucl 14.333, mito_nucl 10.166, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG yli:YALI0F18766g  -  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNIAYPAQGTQKCIDIEDEHRVRGFYEKRMGQEVEADFLGDEFKGYVLKITGGNDKQGFPMKQGVMHPTRVRLLLSKDSSCYRSRRAGERKRKSVRGCIVSSDLSVLSVVIVKQGDADIEGLTTETVPRRLGPKRANNIRKLFALSKEDDVRQYVIRREVTTKSGKTYTKAPKIQRLITPRRLAHKAQLREKKVKAIQASKDAAAEYAQLLAKRVAEKKSEKAEEKKRRASSLRTQSVQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.28
4 0.25
5 0.28
6 0.35
7 0.36
8 0.32
9 0.33
10 0.32
11 0.3
12 0.34
13 0.34
14 0.3
15 0.37
16 0.39
17 0.41
18 0.46
19 0.46
20 0.38
21 0.41
22 0.35
23 0.28
24 0.25
25 0.22
26 0.16
27 0.15
28 0.15
29 0.08
30 0.07
31 0.05
32 0.05
33 0.05
34 0.05
35 0.07
36 0.07
37 0.09
38 0.1
39 0.13
40 0.2
41 0.21
42 0.26
43 0.26
44 0.26
45 0.27
46 0.33
47 0.31
48 0.25
49 0.31
50 0.26
51 0.28
52 0.29
53 0.33
54 0.29
55 0.35
56 0.34
57 0.3
58 0.31
59 0.29
60 0.28
61 0.24
62 0.26
63 0.28
64 0.31
65 0.29
66 0.3
67 0.32
68 0.34
69 0.35
70 0.34
71 0.3
72 0.34
73 0.37
74 0.45
75 0.53
76 0.61
77 0.68
78 0.74
79 0.8
80 0.8
81 0.84
82 0.78
83 0.77
84 0.74
85 0.69
86 0.6
87 0.52
88 0.47
89 0.39
90 0.35
91 0.26
92 0.18
93 0.12
94 0.1
95 0.07
96 0.05
97 0.05
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.06
116 0.06
117 0.07
118 0.13
119 0.16
120 0.24
121 0.32
122 0.4
123 0.49
124 0.59
125 0.65
126 0.68
127 0.69
128 0.64
129 0.57
130 0.52
131 0.45
132 0.38
133 0.35
134 0.29
135 0.29
136 0.29
137 0.28
138 0.25
139 0.24
140 0.22
141 0.21
142 0.22
143 0.21
144 0.24
145 0.25
146 0.25
147 0.27
148 0.28
149 0.31
150 0.35
151 0.33
152 0.32
153 0.36
154 0.36
155 0.35
156 0.42
157 0.46
158 0.49
159 0.55
160 0.56
161 0.59
162 0.64
163 0.67
164 0.65
165 0.65
166 0.64
167 0.65
168 0.68
169 0.62
170 0.63
171 0.63
172 0.58
173 0.57
174 0.58
175 0.58
176 0.6
177 0.66
178 0.66
179 0.7
180 0.7
181 0.71
182 0.66
183 0.63
184 0.61
185 0.6
186 0.58
187 0.58
188 0.59
189 0.5
190 0.46
191 0.4
192 0.32
193 0.24
194 0.19
195 0.11
196 0.12
197 0.12
198 0.12
199 0.13
200 0.14
201 0.16
202 0.21
203 0.26
204 0.27
205 0.33
206 0.38
207 0.45
208 0.54
209 0.6
210 0.62
211 0.67
212 0.74
213 0.78
214 0.82
215 0.84
216 0.8
217 0.8
218 0.79
219 0.78
220 0.77
221 0.77
222 0.77