Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074X220

Protein Details
Accession A0A074X220    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKLHNRRRTRLRPNKKARHQSIDITHydrophilic
NLS Segment(s)
PositionSequence
6-19NRRRTRLRPNKKAR
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MGKLHNRRRTRLRPNKKARHQSIDITSPSSSPGTIQATINDDMSFCSERSSLHHAIQDSTSYHLNDQYEVRHMQYYGDGEGDESGDLCPLMLQVVLDLFDGVDYEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.95
3 0.95
4 0.95
5 0.92
6 0.9
7 0.82
8 0.78
9 0.73
10 0.69
11 0.59
12 0.5
13 0.42
14 0.33
15 0.31
16 0.24
17 0.17
18 0.11
19 0.14
20 0.14
21 0.15
22 0.16
23 0.15
24 0.19
25 0.19
26 0.19
27 0.15
28 0.12
29 0.11
30 0.13
31 0.13
32 0.09
33 0.1
34 0.09
35 0.1
36 0.14
37 0.2
38 0.2
39 0.2
40 0.22
41 0.21
42 0.22
43 0.22
44 0.2
45 0.14
46 0.13
47 0.13
48 0.12
49 0.12
50 0.13
51 0.13
52 0.13
53 0.14
54 0.13
55 0.15
56 0.15
57 0.16
58 0.15
59 0.15
60 0.14
61 0.15
62 0.15
63 0.13
64 0.12
65 0.11
66 0.1
67 0.1
68 0.1
69 0.07
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.05
78 0.04
79 0.04
80 0.04
81 0.05
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.05