Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074X4C7

Protein Details
Accession A0A074X4C7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
393-416IKAPYPIKAGWRQRRQAARRRELAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, cyto 7.5, mito 5, cyto_nucl 4.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR046985  IP5  
IPR000300  IPPc  
Gene Ontology GO:0016020  C:membrane  
GO:0016791  F:phosphatase activity  
GO:0046856  P:phosphatidylinositol dephosphorylation  
Amino Acid Sequences MGNLNTLFLTFNCGRELVNADYFAASIIKGLSHAQLPPDVIVLSLQEIAPLGQSFLGGSFLSPYFERFSQTIEKLNQSWKHDERYETVLCSNVGMTALMLFAKPQVARNIRGVQTAGTGVGAWEMGNKGAVGVRLAYAIDDGSEMDLTFVAAHLAPHEPAWQRRNLDWRSINENLVFTKVTDAEKTRSRATNNQDVQDETEPLLSSATDDQHTSQEQENGLMKSNSYIFFGGDLNYRTSDIKPHPDNHHAFPRCNDSPEDATHYLHIMPNDQLQREKAAGNTLHHLHEARIDFAPTYKFSKKAQEQAAQMVEDVQKQIKSGKDAVTVPDETEWHWAEHRHPSWCDRVLYLALPGHDPTVHAYNSLSLQPSSDHKPVVLYVSIPTHPVGSTNDIKAPYPIKAGWRQRRQAARRRELAVGVVTYLVMTWEGRVLLVGAVLAIIGAWAALSSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.26
4 0.23
5 0.24
6 0.23
7 0.23
8 0.22
9 0.22
10 0.2
11 0.15
12 0.1
13 0.08
14 0.08
15 0.07
16 0.08
17 0.09
18 0.11
19 0.13
20 0.14
21 0.15
22 0.17
23 0.18
24 0.18
25 0.18
26 0.15
27 0.13
28 0.12
29 0.11
30 0.1
31 0.1
32 0.09
33 0.08
34 0.08
35 0.08
36 0.1
37 0.09
38 0.08
39 0.07
40 0.07
41 0.07
42 0.07
43 0.09
44 0.07
45 0.07
46 0.09
47 0.09
48 0.12
49 0.12
50 0.13
51 0.16
52 0.17
53 0.2
54 0.17
55 0.22
56 0.27
57 0.29
58 0.35
59 0.34
60 0.38
61 0.38
62 0.46
63 0.47
64 0.45
65 0.52
66 0.49
67 0.52
68 0.52
69 0.52
70 0.48
71 0.48
72 0.45
73 0.38
74 0.35
75 0.3
76 0.26
77 0.23
78 0.19
79 0.13
80 0.11
81 0.09
82 0.08
83 0.06
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.08
90 0.09
91 0.12
92 0.21
93 0.25
94 0.28
95 0.34
96 0.4
97 0.38
98 0.39
99 0.37
100 0.28
101 0.26
102 0.23
103 0.17
104 0.1
105 0.09
106 0.07
107 0.06
108 0.06
109 0.04
110 0.05
111 0.05
112 0.05
113 0.06
114 0.05
115 0.06
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.07
124 0.06
125 0.05
126 0.05
127 0.05
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.06
142 0.07
143 0.07
144 0.12
145 0.14
146 0.2
147 0.23
148 0.27
149 0.28
150 0.31
151 0.4
152 0.38
153 0.43
154 0.43
155 0.43
156 0.45
157 0.45
158 0.43
159 0.35
160 0.34
161 0.26
162 0.22
163 0.19
164 0.12
165 0.12
166 0.12
167 0.12
168 0.13
169 0.15
170 0.17
171 0.22
172 0.25
173 0.28
174 0.29
175 0.32
176 0.37
177 0.41
178 0.47
179 0.45
180 0.45
181 0.41
182 0.38
183 0.38
184 0.32
185 0.27
186 0.17
187 0.15
188 0.12
189 0.11
190 0.1
191 0.07
192 0.07
193 0.07
194 0.08
195 0.07
196 0.08
197 0.09
198 0.11
199 0.11
200 0.13
201 0.13
202 0.14
203 0.13
204 0.15
205 0.17
206 0.16
207 0.17
208 0.15
209 0.14
210 0.12
211 0.14
212 0.12
213 0.1
214 0.1
215 0.08
216 0.09
217 0.09
218 0.09
219 0.1
220 0.1
221 0.1
222 0.1
223 0.11
224 0.11
225 0.11
226 0.16
227 0.17
228 0.23
229 0.26
230 0.31
231 0.35
232 0.42
233 0.45
234 0.44
235 0.51
236 0.46
237 0.44
238 0.4
239 0.43
240 0.36
241 0.35
242 0.32
243 0.26
244 0.26
245 0.26
246 0.31
247 0.24
248 0.23
249 0.21
250 0.21
251 0.18
252 0.17
253 0.16
254 0.11
255 0.1
256 0.15
257 0.17
258 0.17
259 0.18
260 0.17
261 0.19
262 0.19
263 0.19
264 0.14
265 0.17
266 0.18
267 0.18
268 0.21
269 0.22
270 0.21
271 0.21
272 0.21
273 0.16
274 0.19
275 0.18
276 0.17
277 0.15
278 0.15
279 0.14
280 0.15
281 0.17
282 0.14
283 0.19
284 0.2
285 0.22
286 0.24
287 0.34
288 0.37
289 0.44
290 0.49
291 0.49
292 0.49
293 0.51
294 0.51
295 0.41
296 0.35
297 0.3
298 0.24
299 0.18
300 0.18
301 0.14
302 0.13
303 0.13
304 0.17
305 0.16
306 0.19
307 0.22
308 0.24
309 0.27
310 0.28
311 0.29
312 0.3
313 0.28
314 0.25
315 0.22
316 0.2
317 0.16
318 0.2
319 0.18
320 0.15
321 0.16
322 0.18
323 0.2
324 0.29
325 0.32
326 0.33
327 0.34
328 0.37
329 0.42
330 0.46
331 0.43
332 0.34
333 0.33
334 0.29
335 0.27
336 0.27
337 0.22
338 0.17
339 0.17
340 0.17
341 0.15
342 0.13
343 0.13
344 0.14
345 0.16
346 0.15
347 0.15
348 0.15
349 0.15
350 0.17
351 0.19
352 0.17
353 0.13
354 0.13
355 0.15
356 0.19
357 0.24
358 0.25
359 0.23
360 0.22
361 0.23
362 0.24
363 0.25
364 0.22
365 0.16
366 0.15
367 0.19
368 0.19
369 0.19
370 0.18
371 0.16
372 0.15
373 0.16
374 0.17
375 0.19
376 0.23
377 0.24
378 0.28
379 0.28
380 0.29
381 0.31
382 0.3
383 0.26
384 0.26
385 0.26
386 0.29
387 0.37
388 0.48
389 0.54
390 0.62
391 0.67
392 0.72
393 0.8
394 0.83
395 0.83
396 0.84
397 0.83
398 0.8
399 0.77
400 0.71
401 0.62
402 0.56
403 0.49
404 0.39
405 0.29
406 0.22
407 0.18
408 0.14
409 0.12
410 0.09
411 0.07
412 0.06
413 0.06
414 0.08
415 0.08
416 0.08
417 0.08
418 0.08
419 0.08
420 0.08
421 0.07
422 0.05
423 0.05
424 0.04
425 0.04
426 0.03
427 0.02
428 0.02
429 0.02
430 0.02
431 0.02