Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074W4X3

Protein Details
Accession A0A074W4X3   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-38LSKQRASKACNRCRAKKAKCSGGYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPRKSSHTDESLGDLSKQRASKACNRCRAKKAKCSGGYPCSKCKSSDAVCIFGYARKSKRKTFPEHYVRALEMQQFKLVAGLQTMYFMLLAANSWPGPQLAKREGNPLTHDILESLGLLESDQDEDLEPDMDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.28
4 0.28
5 0.26
6 0.28
7 0.32
8 0.4
9 0.48
10 0.55
11 0.6
12 0.67
13 0.73
14 0.78
15 0.83
16 0.82
17 0.81
18 0.81
19 0.81
20 0.78
21 0.74
22 0.72
23 0.7
24 0.7
25 0.64
26 0.64
27 0.58
28 0.55
29 0.5
30 0.46
31 0.45
32 0.38
33 0.44
34 0.38
35 0.36
36 0.35
37 0.35
38 0.32
39 0.26
40 0.26
41 0.22
42 0.25
43 0.31
44 0.35
45 0.41
46 0.5
47 0.56
48 0.61
49 0.64
50 0.69
51 0.69
52 0.69
53 0.64
54 0.56
55 0.49
56 0.41
57 0.35
58 0.28
59 0.22
60 0.18
61 0.16
62 0.15
63 0.14
64 0.14
65 0.12
66 0.09
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.04
76 0.03
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.08
85 0.1
86 0.16
87 0.21
88 0.27
89 0.28
90 0.35
91 0.37
92 0.39
93 0.41
94 0.38
95 0.34
96 0.29
97 0.28
98 0.22
99 0.19
100 0.16
101 0.13
102 0.1
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.07
110 0.07
111 0.07
112 0.09
113 0.1