Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CD45

Protein Details
Accession Q6CD45    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-39MAGGKTRKKKWSAQKMKDKAQHHBasic
NLS Segment(s)
PositionSequence
18-31AGGKTRKKKWSAQK
Subcellular Location(s) mito 16, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG yli:YALI0C03872g  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKVQQTKAAKAAAAMAGGKTRKKKWSAQKMKDKAQHHVILDQPLYDRIFKEAATFKLVSVSVLVDRLKIGGSLARVALRDLEAKGIIKPVVKHSKQYTFTRTAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.19
4 0.13
5 0.16
6 0.18
7 0.23
8 0.26
9 0.31
10 0.37
11 0.42
12 0.5
13 0.56
14 0.65
15 0.72
16 0.76
17 0.82
18 0.83
19 0.87
20 0.86
21 0.77
22 0.72
23 0.68
24 0.62
25 0.52
26 0.47
27 0.4
28 0.36
29 0.33
30 0.27
31 0.2
32 0.17
33 0.17
34 0.14
35 0.12
36 0.11
37 0.11
38 0.11
39 0.13
40 0.14
41 0.14
42 0.17
43 0.17
44 0.15
45 0.17
46 0.17
47 0.14
48 0.11
49 0.11
50 0.07
51 0.09
52 0.1
53 0.07
54 0.07
55 0.08
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.12
69 0.11
70 0.12
71 0.13
72 0.13
73 0.14
74 0.15
75 0.16
76 0.17
77 0.18
78 0.26
79 0.36
80 0.36
81 0.43
82 0.48
83 0.56
84 0.6
85 0.65
86 0.64
87 0.59