Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074WSQ2

Protein Details
Accession A0A074WSQ2    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
221-241DTKPAPKKRGRPAKATARRGPBasic
NLS Segment(s)
PositionSequence
72-88AKKTGAKKGAAKKGKKA
120-147KPAAKKRGRPAKTAAAAAKKTGGKKRKA
223-253KPAPKKRGRPAKATARRGPAKKAAANKTGRK
Subcellular Location(s) nucl 13.5cyto_nucl 13.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MSDAPDTTFSAGESKLLISIIKNLTGNLESDWDAVAAELNYKDAAIARTRWNQIRRKKITGPASASSSTTTAKKTGAKKGAAKKGKKAASESEDDDEGETKAVIRTEEEDEDEDEEEEAKPAAKKRGRPAKTAAAAAKKTGGKKRKAAATAVSDSEDEQEMKTLVKKVKTEVVEEEAAVGAAADAETPPEAEVPADAGDKADAAVDNAPTAASDNEEEEEDTKPAPKKRGRPAKATARRGPAKKAAANKTGRKAATATTAASDDEDEEEGSTLAKKVKNEGAGDEEAGVDADEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.11
5 0.09
6 0.17
7 0.18
8 0.2
9 0.2
10 0.2
11 0.22
12 0.22
13 0.22
14 0.16
15 0.17
16 0.14
17 0.14
18 0.15
19 0.11
20 0.1
21 0.09
22 0.1
23 0.07
24 0.09
25 0.08
26 0.09
27 0.09
28 0.09
29 0.09
30 0.1
31 0.12
32 0.13
33 0.17
34 0.23
35 0.3
36 0.36
37 0.44
38 0.5
39 0.57
40 0.63
41 0.71
42 0.72
43 0.73
44 0.74
45 0.75
46 0.75
47 0.75
48 0.71
49 0.63
50 0.6
51 0.53
52 0.47
53 0.39
54 0.32
55 0.25
56 0.21
57 0.19
58 0.16
59 0.19
60 0.25
61 0.29
62 0.37
63 0.42
64 0.46
65 0.53
66 0.61
67 0.68
68 0.7
69 0.69
70 0.67
71 0.69
72 0.68
73 0.63
74 0.57
75 0.54
76 0.5
77 0.5
78 0.44
79 0.37
80 0.33
81 0.3
82 0.26
83 0.2
84 0.15
85 0.11
86 0.09
87 0.07
88 0.07
89 0.08
90 0.07
91 0.07
92 0.1
93 0.12
94 0.13
95 0.14
96 0.14
97 0.14
98 0.15
99 0.14
100 0.12
101 0.09
102 0.09
103 0.08
104 0.07
105 0.07
106 0.07
107 0.08
108 0.11
109 0.2
110 0.23
111 0.28
112 0.37
113 0.48
114 0.5
115 0.52
116 0.55
117 0.55
118 0.54
119 0.53
120 0.47
121 0.42
122 0.39
123 0.36
124 0.34
125 0.28
126 0.3
127 0.34
128 0.38
129 0.37
130 0.42
131 0.47
132 0.48
133 0.48
134 0.45
135 0.42
136 0.39
137 0.36
138 0.31
139 0.27
140 0.21
141 0.19
142 0.18
143 0.14
144 0.09
145 0.07
146 0.07
147 0.07
148 0.07
149 0.09
150 0.13
151 0.15
152 0.18
153 0.19
154 0.21
155 0.27
156 0.28
157 0.28
158 0.25
159 0.26
160 0.23
161 0.22
162 0.2
163 0.14
164 0.12
165 0.1
166 0.07
167 0.03
168 0.03
169 0.03
170 0.02
171 0.02
172 0.03
173 0.03
174 0.03
175 0.03
176 0.04
177 0.04
178 0.04
179 0.04
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.05
189 0.04
190 0.05
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.07
198 0.06
199 0.06
200 0.07
201 0.08
202 0.09
203 0.09
204 0.1
205 0.1
206 0.11
207 0.11
208 0.11
209 0.15
210 0.2
211 0.24
212 0.33
213 0.39
214 0.47
215 0.57
216 0.68
217 0.68
218 0.71
219 0.75
220 0.78
221 0.81
222 0.81
223 0.78
224 0.76
225 0.79
226 0.74
227 0.72
228 0.69
229 0.66
230 0.62
231 0.64
232 0.62
233 0.63
234 0.68
235 0.69
236 0.68
237 0.67
238 0.62
239 0.55
240 0.49
241 0.42
242 0.41
243 0.35
244 0.28
245 0.23
246 0.24
247 0.22
248 0.21
249 0.19
250 0.12
251 0.12
252 0.12
253 0.1
254 0.1
255 0.1
256 0.09
257 0.1
258 0.1
259 0.1
260 0.15
261 0.17
262 0.18
263 0.24
264 0.3
265 0.36
266 0.36
267 0.38
268 0.39
269 0.38
270 0.37
271 0.31
272 0.25
273 0.19
274 0.18