Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6C7C7

Protein Details
Accession Q6C7C7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
369-392FPYFNCPKSKKCHGCKPGRFTTDDHydrophilic
NLS Segment(s)
PositionSequence
172-178KAKKAGK
Subcellular Location(s) golg 10, E.R. 7, mito 3, extr 3, plas 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002685  Glyco_trans_15  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0016020  C:membrane  
GO:0000026  F:alpha-1,2-mannosyltransferase activity  
GO:0000032  P:cell wall mannoprotein biosynthetic process  
GO:0097502  P:mannosylation  
GO:0006487  P:protein N-linked glycosylation  
GO:0006493  P:protein O-linked glycosylation  
KEGG yli:YALI0E01892g  -  
Pfam View protein in Pfam  
PF01793  Glyco_transf_15  
Amino Acid Sequences MTPLIVRRLFLLLVTASLGLLVFLIYFSLQDDWTRTHADFLKEESIYKQPNDAFLQYTEPKEDLTPKNNPLLEEVDEPVSAKPLVRATDTRRTKAALISLVRNKELDGIVDAMVQVEDTFNHKFGYPWIFFNDEEFTDEFKEKVREQTDSEVKFELIEKKDWDAPRWIDKDKAKKAGKKLEDAGVRYGAMDSYHKMCRWNSGMFYKHKAMDDYDWYWRVEPDTQYYCDIDYDVFAYMEDNDKVYGFTIALFDNPKTVATLWPETKSFLMKNKEYLHKDNAMQFLLNPSRPDWNAQAGGYSTCHFWSNFEIASLKFFRGDAYAQWFEHLDKQGGFFYERWGDAPVHSVGAGLFANQSQIHWFKDIGYYHFPYFNCPKSKKCHGCKPGRFTTDDLKDSLMPENCLPQYLKYMGDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.09
4 0.09
5 0.09
6 0.06
7 0.05
8 0.04
9 0.03
10 0.03
11 0.04
12 0.04
13 0.04
14 0.06
15 0.07
16 0.08
17 0.1
18 0.12
19 0.15
20 0.18
21 0.21
22 0.2
23 0.25
24 0.29
25 0.32
26 0.31
27 0.33
28 0.37
29 0.34
30 0.35
31 0.32
32 0.34
33 0.34
34 0.33
35 0.34
36 0.29
37 0.34
38 0.37
39 0.36
40 0.31
41 0.28
42 0.34
43 0.31
44 0.32
45 0.29
46 0.25
47 0.25
48 0.24
49 0.32
50 0.31
51 0.34
52 0.4
53 0.4
54 0.47
55 0.48
56 0.46
57 0.41
58 0.38
59 0.35
60 0.3
61 0.28
62 0.22
63 0.21
64 0.21
65 0.18
66 0.16
67 0.13
68 0.11
69 0.12
70 0.14
71 0.16
72 0.19
73 0.25
74 0.3
75 0.4
76 0.45
77 0.46
78 0.44
79 0.44
80 0.42
81 0.4
82 0.37
83 0.34
84 0.31
85 0.36
86 0.4
87 0.4
88 0.39
89 0.36
90 0.32
91 0.28
92 0.25
93 0.18
94 0.14
95 0.13
96 0.12
97 0.12
98 0.12
99 0.09
100 0.08
101 0.07
102 0.05
103 0.04
104 0.05
105 0.08
106 0.09
107 0.1
108 0.1
109 0.11
110 0.11
111 0.14
112 0.21
113 0.2
114 0.2
115 0.22
116 0.24
117 0.24
118 0.26
119 0.25
120 0.17
121 0.18
122 0.17
123 0.16
124 0.16
125 0.16
126 0.15
127 0.15
128 0.18
129 0.17
130 0.23
131 0.24
132 0.24
133 0.26
134 0.34
135 0.39
136 0.37
137 0.38
138 0.31
139 0.29
140 0.27
141 0.27
142 0.26
143 0.2
144 0.21
145 0.21
146 0.22
147 0.28
148 0.29
149 0.28
150 0.27
151 0.28
152 0.34
153 0.36
154 0.36
155 0.37
156 0.41
157 0.49
158 0.5
159 0.57
160 0.55
161 0.57
162 0.63
163 0.66
164 0.64
165 0.58
166 0.55
167 0.51
168 0.49
169 0.45
170 0.38
171 0.3
172 0.26
173 0.21
174 0.18
175 0.12
176 0.09
177 0.08
178 0.08
179 0.1
180 0.13
181 0.14
182 0.16
183 0.16
184 0.2
185 0.23
186 0.24
187 0.24
188 0.27
189 0.32
190 0.32
191 0.36
192 0.34
193 0.32
194 0.31
195 0.29
196 0.25
197 0.21
198 0.23
199 0.21
200 0.22
201 0.22
202 0.21
203 0.21
204 0.19
205 0.18
206 0.17
207 0.16
208 0.18
209 0.19
210 0.2
211 0.21
212 0.21
213 0.2
214 0.17
215 0.16
216 0.11
217 0.08
218 0.07
219 0.06
220 0.06
221 0.05
222 0.06
223 0.06
224 0.08
225 0.08
226 0.07
227 0.07
228 0.07
229 0.08
230 0.08
231 0.08
232 0.05
233 0.05
234 0.06
235 0.06
236 0.07
237 0.09
238 0.08
239 0.09
240 0.09
241 0.09
242 0.09
243 0.09
244 0.11
245 0.13
246 0.19
247 0.2
248 0.22
249 0.22
250 0.22
251 0.23
252 0.23
253 0.21
254 0.24
255 0.29
256 0.28
257 0.34
258 0.4
259 0.47
260 0.5
261 0.53
262 0.51
263 0.48
264 0.49
265 0.47
266 0.44
267 0.36
268 0.3
269 0.25
270 0.27
271 0.26
272 0.25
273 0.21
274 0.2
275 0.24
276 0.24
277 0.27
278 0.23
279 0.24
280 0.25
281 0.23
282 0.23
283 0.19
284 0.2
285 0.18
286 0.16
287 0.12
288 0.11
289 0.13
290 0.11
291 0.12
292 0.15
293 0.17
294 0.16
295 0.16
296 0.17
297 0.16
298 0.2
299 0.21
300 0.17
301 0.15
302 0.15
303 0.14
304 0.15
305 0.16
306 0.14
307 0.2
308 0.23
309 0.22
310 0.23
311 0.24
312 0.23
313 0.28
314 0.28
315 0.22
316 0.19
317 0.21
318 0.22
319 0.23
320 0.24
321 0.18
322 0.2
323 0.21
324 0.21
325 0.21
326 0.21
327 0.2
328 0.18
329 0.22
330 0.18
331 0.15
332 0.14
333 0.13
334 0.1
335 0.12
336 0.11
337 0.08
338 0.08
339 0.07
340 0.09
341 0.09
342 0.1
343 0.13
344 0.16
345 0.17
346 0.19
347 0.19
348 0.18
349 0.25
350 0.27
351 0.27
352 0.31
353 0.33
354 0.34
355 0.38
356 0.37
357 0.38
358 0.42
359 0.45
360 0.48
361 0.48
362 0.53
363 0.57
364 0.68
365 0.72
366 0.75
367 0.78
368 0.79
369 0.86
370 0.89
371 0.9
372 0.89
373 0.83
374 0.76
375 0.7
376 0.7
377 0.67
378 0.59
379 0.51
380 0.44
381 0.4
382 0.39
383 0.42
384 0.34
385 0.28
386 0.27
387 0.33
388 0.3
389 0.33
390 0.32
391 0.27
392 0.3
393 0.29