Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C263

Protein Details
Accession Q6C263    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-39RLKLKGDKGKVTKSKKKKISKTSSPAPAPHydrophilic
NLS Segment(s)
PositionSequence
8-31PGGRLKLKGDKGKVTKSKKKKISK
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Gene Ontology GO:0005730  C:nucleolus  
KEGG yli:YALI0F10527g  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MGLYDTKPGGRLKLKGDKGKVTKSKKKKISKTSSPAPAPSSSPPTMSLPSAKDIAKSPHDTEHAKESISETPPSVETKGAIPIPGSSSKRMDKAKIAASTSPVETTRTPKEPYLTDAQKKFEEAKKERLMEKMTKQKPFKERVQDYNDHLSKLTDQNEMPKISG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.64
4 0.66
5 0.67
6 0.73
7 0.75
8 0.75
9 0.77
10 0.79
11 0.84
12 0.85
13 0.88
14 0.88
15 0.9
16 0.9
17 0.91
18 0.88
19 0.87
20 0.86
21 0.79
22 0.71
23 0.63
24 0.54
25 0.47
26 0.42
27 0.39
28 0.31
29 0.28
30 0.28
31 0.27
32 0.27
33 0.25
34 0.25
35 0.2
36 0.21
37 0.23
38 0.2
39 0.19
40 0.2
41 0.23
42 0.25
43 0.27
44 0.27
45 0.28
46 0.32
47 0.32
48 0.31
49 0.32
50 0.28
51 0.24
52 0.23
53 0.21
54 0.22
55 0.22
56 0.21
57 0.15
58 0.15
59 0.16
60 0.17
61 0.16
62 0.11
63 0.09
64 0.1
65 0.12
66 0.11
67 0.1
68 0.09
69 0.09
70 0.11
71 0.15
72 0.16
73 0.16
74 0.19
75 0.21
76 0.26
77 0.28
78 0.28
79 0.26
80 0.29
81 0.33
82 0.33
83 0.33
84 0.28
85 0.28
86 0.28
87 0.25
88 0.22
89 0.16
90 0.16
91 0.15
92 0.2
93 0.22
94 0.25
95 0.26
96 0.27
97 0.29
98 0.28
99 0.31
100 0.35
101 0.37
102 0.4
103 0.41
104 0.43
105 0.41
106 0.42
107 0.43
108 0.39
109 0.42
110 0.4
111 0.46
112 0.51
113 0.54
114 0.54
115 0.54
116 0.55
117 0.52
118 0.56
119 0.57
120 0.57
121 0.62
122 0.64
123 0.67
124 0.71
125 0.71
126 0.7
127 0.71
128 0.71
129 0.71
130 0.75
131 0.72
132 0.69
133 0.72
134 0.65
135 0.55
136 0.48
137 0.4
138 0.37
139 0.37
140 0.34
141 0.28
142 0.27
143 0.34
144 0.39