Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074WMG6

Protein Details
Accession A0A074WMG6    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-117KMAAKMHQKRVDRLKRREKRNKLLKSBasic
NLS Segment(s)
PositionSequence
66-117KEAERQRRITALKEKREAKEEKERYEKMAAKMHQKRVDRLKRREKRNKLLKS
Subcellular Location(s) nucl 19, mito 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTVTSDTPIAKTPQTSGMRKNGKQWHETKKAFRPTAGQTSYAKRQAKDQALAVVKAQEKEMKEEKEAERQRRITALKEKREAKEEKERYEKMAAKMHQKRVDRLKRREKRNKLLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.37
4 0.4
5 0.47
6 0.54
7 0.55
8 0.62
9 0.61
10 0.59
11 0.63
12 0.65
13 0.65
14 0.66
15 0.7
16 0.69
17 0.7
18 0.74
19 0.68
20 0.61
21 0.56
22 0.51
23 0.55
24 0.49
25 0.42
26 0.35
27 0.39
28 0.44
29 0.47
30 0.44
31 0.35
32 0.38
33 0.43
34 0.45
35 0.42
36 0.37
37 0.35
38 0.34
39 0.34
40 0.28
41 0.24
42 0.21
43 0.19
44 0.18
45 0.15
46 0.14
47 0.18
48 0.24
49 0.21
50 0.21
51 0.26
52 0.28
53 0.35
54 0.41
55 0.42
56 0.44
57 0.44
58 0.44
59 0.45
60 0.45
61 0.41
62 0.45
63 0.48
64 0.49
65 0.55
66 0.6
67 0.57
68 0.62
69 0.59
70 0.55
71 0.57
72 0.56
73 0.56
74 0.59
75 0.58
76 0.54
77 0.59
78 0.58
79 0.52
80 0.54
81 0.51
82 0.53
83 0.6
84 0.65
85 0.65
86 0.63
87 0.67
88 0.69
89 0.77
90 0.76
91 0.79
92 0.81
93 0.82
94 0.9
95 0.92
96 0.92
97 0.92