Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074W7T6

Protein Details
Accession A0A074W7T6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRASNGRNKKGRGHVKPVRCSNCSHydrophilic
82-116KIVRVRSREGRRNRAPPPRVRFNKDGKKINPQQAAHydrophilic
NLS Segment(s)
PositionSequence
4-17KRASNGRNKKGRGH
85-109RVRSREGRRNRAPPPRVRFNKDGKK
Subcellular Location(s) mito 11.5, mito_nucl 11, nucl 9.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRASNGRNKKGRGHVKPVRCSNCSRCVPKDKAVKRFTIRNMVESAAIRDISDASVFAEYAVPKMYLKLQYCISCAIHGKIVRVRSREGRRNRAPPPRVRFNKDGKKINPQQAAKVAAGAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.77
6 0.82
7 0.84
8 0.8
9 0.73
10 0.72
11 0.68
12 0.69
13 0.67
14 0.64
15 0.61
16 0.64
17 0.66
18 0.67
19 0.7
20 0.68
21 0.7
22 0.67
23 0.68
24 0.63
25 0.65
26 0.61
27 0.61
28 0.54
29 0.46
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.12
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.06
53 0.07
54 0.1
55 0.14
56 0.15
57 0.18
58 0.2
59 0.21
60 0.22
61 0.24
62 0.22
63 0.18
64 0.19
65 0.17
66 0.19
67 0.19
68 0.2
69 0.21
70 0.27
71 0.3
72 0.31
73 0.34
74 0.39
75 0.48
76 0.54
77 0.61
78 0.64
79 0.69
80 0.75
81 0.79
82 0.8
83 0.79
84 0.8
85 0.79
86 0.8
87 0.79
88 0.78
89 0.77
90 0.78
91 0.8
92 0.79
93 0.81
94 0.74
95 0.77
96 0.79
97 0.8
98 0.79
99 0.71
100 0.68
101 0.64
102 0.64
103 0.53
104 0.45