Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XAM8

Protein Details
Accession A0A074XAM8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-112AYNAKRHSKKERRSLRRAAAHydrophilic
NLS Segment(s)
PositionSequence
97-109KRHSKKERRSLRR
135-187AGKGEKGAKNAGLLGNKGQKLPKGVLPGGKHAVGKIDERAKHNKEQAIKRNEK
Subcellular Location(s) mito 16, cyto_nucl 6.5, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
IPR039193  S17mt  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences VGVVVSAGKMQNTVKVRLPSQKWNNYLRKHFKDHSDHLVHDPKSSLNIGDVVALRPFRAAKHVHHVVSEILVPFGTPITQRPPIPSAGESEAAYNAKRHSKKERRSLRRAAAQGSESAIAKLDAMEVEAGQGVKAGKGEKGAKNAGLLGNKGQKLPKGVLPGGKHAVGKIDERAKHNKEQAIKRNEKAEKNLLEAKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.39
4 0.46
5 0.51
6 0.54
7 0.61
8 0.66
9 0.65
10 0.71
11 0.75
12 0.75
13 0.8
14 0.8
15 0.77
16 0.76
17 0.75
18 0.74
19 0.74
20 0.71
21 0.7
22 0.64
23 0.59
24 0.58
25 0.61
26 0.52
27 0.44
28 0.39
29 0.3
30 0.28
31 0.27
32 0.2
33 0.13
34 0.13
35 0.12
36 0.13
37 0.14
38 0.12
39 0.13
40 0.13
41 0.11
42 0.12
43 0.12
44 0.1
45 0.15
46 0.17
47 0.18
48 0.27
49 0.33
50 0.32
51 0.32
52 0.33
53 0.28
54 0.26
55 0.24
56 0.15
57 0.09
58 0.08
59 0.07
60 0.06
61 0.06
62 0.05
63 0.04
64 0.06
65 0.11
66 0.15
67 0.15
68 0.18
69 0.2
70 0.21
71 0.23
72 0.21
73 0.19
74 0.18
75 0.19
76 0.16
77 0.15
78 0.14
79 0.13
80 0.13
81 0.11
82 0.11
83 0.17
84 0.19
85 0.23
86 0.33
87 0.42
88 0.51
89 0.6
90 0.69
91 0.71
92 0.77
93 0.82
94 0.78
95 0.75
96 0.69
97 0.61
98 0.53
99 0.44
100 0.36
101 0.29
102 0.23
103 0.15
104 0.13
105 0.1
106 0.07
107 0.07
108 0.06
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.05
117 0.04
118 0.06
119 0.05
120 0.06
121 0.07
122 0.08
123 0.08
124 0.13
125 0.2
126 0.22
127 0.26
128 0.28
129 0.28
130 0.28
131 0.29
132 0.27
133 0.23
134 0.21
135 0.21
136 0.26
137 0.26
138 0.27
139 0.27
140 0.26
141 0.29
142 0.3
143 0.29
144 0.29
145 0.31
146 0.36
147 0.36
148 0.39
149 0.39
150 0.38
151 0.35
152 0.28
153 0.3
154 0.26
155 0.26
156 0.27
157 0.31
158 0.34
159 0.39
160 0.48
161 0.49
162 0.55
163 0.59
164 0.58
165 0.59
166 0.65
167 0.7
168 0.72
169 0.74
170 0.7
171 0.74
172 0.76
173 0.73
174 0.7
175 0.69
176 0.62
177 0.61