Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6C6H8

Protein Details
Accession Q6C6H8    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-131KDETKKPRPVTNGIKKRRRPKKITBasic
NLS Segment(s)
PositionSequence
96-131RKLRSGIRKYAAKDETKKPRPVTNGIKKRRRPKKIT
Subcellular Location(s) nucl 18.5, cyto_nucl 14.333, mito_nucl 10.166, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
KEGG yli:YALI0E09427g  -  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd02947  TRX_family  
Amino Acid Sequences MTITDLHSLGEFEEAIKSEELTVIKFSTKTCIPCKMIAPVYEKYSKAYKGAKYYNCDSEELVEVASMVPVSSVPTFALYKNGEIVLIVSGNGADPRKLRSGIRKYAAKDETKKPRPVTNGIKKRRRPKKIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.11
5 0.1
6 0.13
7 0.13
8 0.13
9 0.13
10 0.12
11 0.14
12 0.15
13 0.15
14 0.17
15 0.2
16 0.25
17 0.27
18 0.34
19 0.36
20 0.38
21 0.4
22 0.41
23 0.4
24 0.39
25 0.39
26 0.34
27 0.35
28 0.36
29 0.34
30 0.3
31 0.31
32 0.28
33 0.28
34 0.31
35 0.31
36 0.34
37 0.42
38 0.44
39 0.45
40 0.47
41 0.49
42 0.44
43 0.41
44 0.34
45 0.28
46 0.24
47 0.19
48 0.15
49 0.09
50 0.07
51 0.06
52 0.06
53 0.04
54 0.03
55 0.02
56 0.02
57 0.04
58 0.04
59 0.05
60 0.05
61 0.07
62 0.08
63 0.08
64 0.13
65 0.12
66 0.13
67 0.13
68 0.13
69 0.11
70 0.1
71 0.11
72 0.06
73 0.06
74 0.05
75 0.04
76 0.04
77 0.04
78 0.07
79 0.07
80 0.07
81 0.08
82 0.12
83 0.16
84 0.18
85 0.22
86 0.3
87 0.38
88 0.46
89 0.53
90 0.55
91 0.55
92 0.62
93 0.65
94 0.63
95 0.61
96 0.62
97 0.66
98 0.68
99 0.73
100 0.68
101 0.69
102 0.67
103 0.7
104 0.71
105 0.71
106 0.73
107 0.76
108 0.83
109 0.85
110 0.89
111 0.91