Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074XNR2

Protein Details
Accession A0A074XNR2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21QGKRKSASKPEGKKKRETLSTBasic
NLS Segment(s)
PositionSequence
3-16KRKSASKPEGKKKR
Subcellular Location(s) nucl 12, mito_nucl 11.499, mito 9.5, cyto_nucl 9.333, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences QGKRKSASKPEGKKKRETLSTTFQCLFCNHENSVSVKIDKKASTGELTCKVCGQTFQTVTNYLSAPIDVYSDWVDACD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.79
4 0.74
5 0.7
6 0.7
7 0.69
8 0.65
9 0.59
10 0.5
11 0.43
12 0.37
13 0.36
14 0.29
15 0.28
16 0.23
17 0.22
18 0.23
19 0.23
20 0.26
21 0.22
22 0.2
23 0.19
24 0.2
25 0.22
26 0.2
27 0.19
28 0.17
29 0.17
30 0.18
31 0.17
32 0.2
33 0.23
34 0.25
35 0.24
36 0.24
37 0.23
38 0.2
39 0.2
40 0.2
41 0.2
42 0.21
43 0.23
44 0.24
45 0.26
46 0.26
47 0.27
48 0.24
49 0.17
50 0.15
51 0.12
52 0.11
53 0.09
54 0.1
55 0.08
56 0.1
57 0.11
58 0.11